VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ompH

Gene Name ompH
Sequence Strain (Species/Organism) Pasteurella multocida strain Pm-17
NCBI Nucleotide GI 99083557
NCBI Protein GI 99083558
Protein Accession ABF66676.1
Other Database IDs CDD:225744
CDD:238208
Taxonomy ID 747
Gene Strand (Orientation) ?
Protein Name outer membrane protein
Protein pI 9.15
Protein Weight 34480.88
Protein Length 413
Protein Note Outer membrane protein (porin) [Cell wall/membrane/envelope biogenesis]; COG3203
DNA Sequence
>gi|99083557|gb|DQ417897.1| Pasteurella multocida strain Pm-17 outer membrane protein (ompH) gene, complete cds
ATGAAAAAGACAATCGTAGCATTAGCAGTCGCAGCAGTAGCAGCAACTTCAGCAAACGCAGCAACAGTTT
ACAATCAAGACGGTACAAAAGTTGATGTAAACGGTTCTGTACGTTTACTTCTTAAAAAAGAAAAAGATAT
GCGTGGTGATTTAATTGATAACGGTTCACGCGTTTCTTTCAAAGCATCTCATGACTTAGGTGAAGGCTTA
AGCGTATTAGGTTATGCAGAACTTCGTTTTAGTAAAGATGTGAAAGATAAAGAGGGTAAAGTTAACCAAC
CAATCGGTAACGAAGTTCATGCTAAACGTCTTTATGCGGGTTTTGCGTATGAAGGTTTAGGTACATTAAC
TTTTGGTAACCAATTAACAATTGGTGATGATGTTGGTGTGTCTGATTACACTTATTTTAACAGTGGTATC
AATGGCGTACTTATTACTAGTGGTCAAAAAGCAATTAACTTCAAATCAGCAGAGTTCAACGGTTTCACAT
TTGGTGGTGCGTATGTGTTCTCAGGCGATGCAAACAAAGATGCATTACGTGATGGTCGCGGTTTCGTAGT
AGCAGGTTTATACAACAGACAAATCGGTGATGTTGGTTTTGCATTCGAAGCAGGCTATAGCCAAAAATAT
GTAAAACAGAAAGTTGAACAACCTCAGCCTTTACCTCCTGGTCAAGTAGAGCGTTTCAAAGATGAAAAAG
AAAAAGCTTTCTTGGTCGGTGCAGAATTATCGTACGCTGGTTTAGCGCTTGGTGTTGACTACGCACAATC
TAAAGTGACTAACGTAGATGGTAAAAAACGTGCACTTGAAGTGGGTTTAAACTATGACCTTAATGATAAA
GCGAAAGTTTATACAGACTTCATCTGGGAAAAAGAAGGTCCTAAAGGTGATGTTGAAAGAACTCGCACTG
TAGCTGTAGGTTTTGGTTACAAACTTCACAAACAAGTTGAAACCTTTGTTGAAGGTGCTTGGGGAAGAAC
AAAAGATGCAGATGGTAAAACAACAAAAGATAATGTAGTTGGTACAGGTTTACGCGTACACTTCTAA
Protein Sequence
>ABF66676.1 outer membrane protein [Pasteurella multocida]
MKKTIVALAVAAVAATSANAATVYNQDGTKVDVNGSVRLLLKKEKDMRGDLIDNGSRVSFKASHDLGEGL
SVLGYAELRFSKDVKDKEGKVNQPIGNEVHAKRLYAGFAYEGLGTLTFGNQLTIGDDVGVSDYTYFNSGI
NGVLITSGQKAINFKSAEFNGFTFGGAYVFSGDANKDALRDGRGFVVAGLYNRQIGDVGFAFEAGYSQKY
VKQKVEQPQPLPPGQVERFKDEKEKAFLVGAELSYAGLALGVDYAQSKVTNVDGKKRALEVGLNYDLNDK
AKVYTDFIWEKEGPKGDVERTRTVAVGFGYKLHKQVETFVEGAWGRTKDADGKTTKDNVVGTGLRVHF

Molecule Role Protective antigen
Molecule Role Annotation DNA vaccines with OmpH and OmpA was superior to that provided by monovalent DNA vaccines.(Gong et al., 2013)
Related Vaccines(s) P. multocida DNA vaccine pcDNA-OMPH + pcDNA-OMPA , P. multocida DNA vaccine pcDNA-OMPH/OMPA
References