VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

OmpA

Gene Name OmpA
Sequence Strain (Species/Organism) Pasteurella multocida strain 95010872
NCBI Nucleotide GI 49182347
NCBI Protein GI 49182348
Protein Accession AAT57676.1
Other Database IDs CDD:236764
CDD:279698
CDD:143586
Taxonomy ID 747
Gene Strand (Orientation) ?
Protein Name OmpA
Protein pI 9.2
Protein Weight 34678.17
Protein Length 396
Protein Note outer membrane protein A; Reviewed
DNA Sequence
>gi|49182347|gb|AY643794.1| Pasteurella multocida strain 95010872 OmpA gene, complete cds
ATGAAAAAAACAGCAATTGCATTGACTATCGTTGCACTAGCCGTGGCTTCAGTTGCACAAGCTGCACCAC
AACCTAACACATTCTATGTAGGTGCTAAAGCAGGTTGGGCATCTTTCCACGATGGTTTAAATCAAGCTAA
ATATCTTGAAGCTCCTGAGGCTACATTTGGCTTTAAACGTAATAGCGTTACTTATGGCGTGTTTGGTGAA
TATCAAATCACTGATAATTTTGCAGTAGAGTTAGGCTATGATGATTTTGGTCGTGCGAAGTTACGTATGG
CTGAAAAAGATCAAAAAGCAAAAGATGCAGCAAAACACACTAACCATGGTGCGCATTTAAGCTTAAAAGC
AAGCTATCCTGTACTTGATGGTTTAGATATTTATGCGCGTGTTGGAGCAGCATTAATTCGCTCAGATTAT
AAAGTGTATGATCATTCTGACCCAGCAAAATTACCACAATTTAAGAGAACTCATAGCACCCAAGTTTCTC
CAGTATTCGCAGGTGGTTTAGAATATGCGTTTATGCCTGAGTTAGCTTTACGTGTTGAATACCAATGGGT
AAACAATGTAGGTAAAGTTAAAGATGTTCTTGGAGAACGCGTAGATTACAGACCAGATATCGGCTCTGTA
ACAGCTGGTTTCGGTCAATCTGTTTATGTACCAGAAGTTGTGAGCAAAACATTCACATTAAACTCTGATG
TGACATTCGGTTTCGATAAAGCTGACTTAAAACCAGCTGCACAAAACGTGTTAGATGGTATCTACGGTGA
AATCGCCCAGTTAAAATCTGCCTCTGTTGCAGTTGCTGGTTACACAGACCGTTTAGGTTCTGATGCATAC
AACTTAAAATTATCACAACGTCGTGCTGACACTGTGGCTAACTACTTAGTAGCGAAAGGTGTTGCACAAA
ACGCTATCAGTGCAACAGGTCATGGTGAAGCGAACCCTGTAACTGGTAACAAATGTGATTCAGTTAAAGG
TCGTAAAGCACTTATCGCATGTTTAGCTGACGATCGTCGCGTTGAAATCGCTGTTAAAGGTAACAAATAA
Protein Sequence
>AAT57676.1 OmpA [Pasteurella multocida]
MKKTAIALTIVALAVASVAQAAPQPNTFYVGAKAGWASFHDGLNQAKYLEAPEATFGFKRNSVTYGVFGE
YQITDNFAVELGYDDFGRAKLRMAEKDQKAKDAAKHTNHGAHLSLKASYPVLDGLDIYARVGAALIRSDY
KVYDHSDPAKLPQFKRTHSTQVSPVFAGGLEYAFMPELALRVEYQWVNNVGKVKDVLGERVDYRPDIGSV
TAGFGQSVYVPEVVSKTFTLNSDVTFGFDKADLKPAAQNVLDGIYGEIAQLKSASVAVAGYTDRLGSDAY
NLKLSQRRADTVANYLVAKGVAQNAISATGHGEANPVTGNKCDSVKGRKALIACLADDRRVEIAVKGNK

Molecule Role Protective antigen
Molecule Role Annotation DNA vaccines with OmpH and OmpA was superior to that provided by monovalent DNA vaccines.(Gong et al., 2013)
Related Vaccines(s) P. multocida DNA vaccine pcDNA-OMPH + pcDNA-OMPA , P. multocida DNA vaccine pcDNA-OMPH/OMPA
References