VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ompL1

Gene Name ompL1
Sequence Strain (Species/Organism) Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
NCBI Gene ID 2769678
NCBI Protein GI 45656861
Locus Tag LIC10973
Genbank Accession AE016823
Protein Accession YP_000947
Taxonomy ID 267671
Chromosome No I
Gene Starting Position 1173341
Gene Ending Position 1174303
Gene Strand (Orientation) -
Protein Name outer membrane protein
Protein pI 8.87
Protein Weight 31373.06
Protein Length 320
Protein Note contains porin activity; identified by sequence similarity; ORF located using Blastx/Glimmer
DNA Sequence
>NC_005823.1:1173341-1174303 Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130, chromosome I, complete sequence
CTTAGAGTTCGTGTTTATAACCGAATCTGTAGATTTGCCCACCGACAACGATTGGATATGCAGGAAAAGG
AGAAAGGTTCGTAGCTCCTCCTGCAGATTGAGTTTTACCAACTGCATACGCAGCAGACATGATCGTTTCT
AATTCAAGAAAAACGTGTCCTTTATCGGTTACTCTGGCCTGAGTTCCAATTAAAAAGTTAGGAGCAATTC
CAGAAGTTCTAAATCGAACGTGTTCACGAGTCGTGACTGGATCTGTTCCGTCTGCGATCAAGTTTGCAAC
ACTTCCCGCTCCCGCTGCAGCTAAAATGTCATGACCTCCTTTGAGGTTGTTTGATCCGTTTAAACTCCAT
CCACCATTGAAATAGTTTAAACCTGCTCCCATATATATTGCAGCGTCTTCAGTAACATTCAATTTGATAC
CAACGGTTGCAGGAATGACGATAGAACTAAAACCCCAAGTCATATCTACAATGTTATAACCAGCGATGTC
TGCTTTTGTAATACCGCCAGAAATTTTTTGAGTATATTCTGCAGCAACTCTCCAGAAAAAATATTTACCA
AAGTCGGACTCATAACCTACCATCAAGTTTCCTCCGACCATGGCGCCTTTAGTGCTTCTTGCGTTGATCA
AGCCGCCAGTAGTTCTATCGAGGGTAATCAATTTATTTTCAGCAGGAATCGCTTTTCTGGGAGCAACTCC
TAGATAATTTCCTTCACCTGTAGGTTTTCCTGGATTTTGTACACAAGTAGGATCGTTTGGACCTACTGTA
CAAGTATCTGTTGATCGGACCGGGCCATAATAACTTGCAGCGTCTAAACCATCTTTGGTGATGGTTCCTC
CTAATTGTCCTAGGTCTAACTGTAACCCAAATCCTACAATTGCATATGTTTTTGCACTTAGGCTTGCAGC
CGAAGATAATGCTACGGCTAAAATGAGCAATGCCTTACTTATGTTACGGATCA

Protein Sequence
>YP_000947.1 outer membrane protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130]
MIRNISKALLILAVALSSAASLSAKTYAIVGFGLQLDLGQLGGTITKDGLDAASYYGPVRSTDTCTVGPN
DPTCVQNPGKPTGEGNYLGVAPRKAIPAENKLITLDRTTGGLINARSTKGAMVGGNLMVGYESDFGKYFF
WRVAAEYTQKISGGITKADIAGYNIVDMTWGFSSIVIPATVGIKLNVTEDAAIYMGAGLNYFNGGWSLNG
SNNLKGGHDILAAAGAGSVANLIADGTDPVTTREHVRFRTSGIAPNFLIGTQARVTDKGHVFLELETIMS
AAYAVGKTQSAGGATNLSPFPAYPIVVGGQIYRFGYKHEL

Molecule Role Protective antigen
Related Vaccines(s) Leptospira interrogans DNA vaccine ompL1-pcDNA3.1(+)
References