VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

F

Gene Name F
Sequence Strain (Species/Organism) Human respiratory syncytial virus A
NCBI Protein GI 306438651
Other Database IDs CDD:278924
GOA:E0WLR1
InterPro: IPR000776
UniProtKB/TrEMBL: E0WLR1
Taxonomy ID 208893
Gene Strand (Orientation) ?
Protein Name F protein
Protein pI 10.23
Protein Weight 18105.35
Protein Length 239
Protein Note Fusion glycoprotein F0; pfam00523
Protein Sequence
>CBW45366.1 F protein, partial [Human respiratory syncytial virus A]
MELPILKTNAITTIFAAVTLCFASSQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPAANNRARRELPRFMNYTLNNTKNNNVTLSKKRKRRFLGF
LLGVGSAIASGIAVSKVLHLEGEVNK

Molecule Role Protective antigen
Related Vaccines(s) HRSV DNA vaccine DRF-412
References