VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

GPX1

Gene Name GPX1
Sequence Strain (Species/Organism) Schistosoma mansoni
NCBI Protein GI 212287928
Other Database IDs CDD:238207
CDD:278975
Taxonomy ID 6183
Gene Strand (Orientation) ?
Protein Name Glutathione peroxidase
Protein pI 9.34
Protein Weight 19887.514
Protein Length 245
Protein Note GPX
Protein Sequence
>sp|Q00277.2|GPX1_SCHMA RecName: Full=Glutathione peroxidase; Short=GPX
MSSSHKSWNSIYEFTVKDINGVDVSLEKYRGHVCLIVNVACKUGATDKNYRQLQEMHTRLVGKGLRILAF
PCNQFGGQEPWAEAEIKKFVTEKYGVQFDMFSKIKVNGSDADDLYKFLKSRQHGTLTNNIKWNFSKFLVD
RQGQPVKRYSPTTAPYDIEGDIMELLEKK

Molecule Role Protective antigen
Related Vaccines(s) S. mansoni DNA vaccine pcDNA/GPXbb encoding glutathione-S-peroxidase, GPX
References