VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Caf1 from Y. pestis biovar Microtus str. 91001

Gene Name Caf1 from Y. pestis biovar Microtus str. 91001
Sequence Strain (Species/Organism) Yersinia pestis biovar Microtus str. 91001
VO ID VO_0010870
NCBI Gene ID 2767670
NCBI Protein GI 45478667
Locus Tag YP_pMT082
Genbank Accession AE017045
Protein Accession NP_995523
Taxonomy ID 229193
Plasmid No pMT1
Gene Starting Position 73339
Gene Ending Position 73851
Gene Strand (Orientation) -
Protein Name F1 capsule antigen
Protein pI 4.63
Protein Weight 16375.93
Protein Length 170
Protein Note Best Blastp hit = gi|115437|sp|P26948|CAF1_YERPE F1 capsule antigen precursor, gi|96993|pir||S13008 capsular antigen F1 precursor Yersinia pestis plasmid pMT01, gi|48621|emb|CAA43966.1| (X61996) F1 capsule antigen [Yersinia pestis], gi|2996338| gb|AAC13218.1| (AF053947) F1 capsule antigen [Yersinia pestis], gi|3883098|gb|AAC82758.1| (AF074611) F1 capsule antigen [Yersinia pestis], gi|5834767|emb|CAB55266.1| (AL117211) putative F1 capsule antigen [Yersinia pestis]
DNA Sequence
>NC_005815.1:73339-73851 Yersinia pestis biovar Microtus str. 91001 plasmid pMT1, complete sequence
ATTATTGGTTAGATACGGTTACGGTTACAGCATCAGTGTATTTACCTGCTGCAAGTTTACCGCCTTTGGA
ACCAATTGAGCGAACAAAGAAATCCTGGCTGCCCGTAGCCAAGACGACGTCATCCCCCACAAGGTTCTCA
CCGTTTACCTTAGGAGAGATATCAAAATCTCTAGAATCCTTGCCAATCACTTTTGTAGTGAATTGGTGGT
TATTTCCATCCTGAGAAGTAAATGTTAAGTACATGGGATCACCCGCGGCATCTGTAAAGTTAACAGATGT
GCTAGTGGTTCCTGTTTTATAGCCGCCAAGAGTAAGCGTACCAACAAGTAATTCTGTATCGATGTTTCCA
TTGTCCATAATTGTAATTGGAGCGCCTTCCTTATATGTAAGAGTGATGCGGGCTGGTTCAACAAGAGTTG
CCGTTGCAGTGGTGCTTGCAGTTAAATCTGCCGCATTAGCAGTTGCAATAGTTCCAAATAATGCAATGGC
GATAACGGAACTGATTTTTTTCA

Protein Sequence
>NP_995523.1 F1 capsule antigen (plasmid) [Yersinia pestis biovar Microtus str. 91001]
MKKISSVIAIALFGTIATANAADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLG
GYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQ
DFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Molecule Role Protective antigen
Related Vaccines(s) Y. pestis DNA vaccine F1-V DNA , Y. pestis F1 protein vaccine
References