VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

YscF from Y. pestis KIM 10

Gene Name YscF from Y. pestis KIM 10
Sequence Strain (Species/Organism) Yersinia pestis
VO ID VO_0011001
NCBI Gene ID 1149286
NCBI Protein GI 31795470
Locus Tag D744_p5023
Genbank Accession AF053946
Protein Accession NP_857922
Taxonomy ID 632
Plasmid No pCD1
Gene Starting Position 19544
Gene Ending Position 19807
Gene Strand (Orientation) -
Protein Name type III secretion protein
Protein pI 7.54
Protein Weight 9092.63
Protein Length 87
Protein Note type III secretion apparatus component
DNA Sequence
>NC_004839.1:19544-19807 Yersinia pestis strain KIM5 plasmid pCD1, complete sequence
ATTATGGGAACTTCTGTAGGATGCCTTGCATTAAGTCTTTCATGCTACGAACTATGGTTGAGTTTATATT
GTAAATTACCGACCATTTATTAATTGAATGTTGTAAGTCAGCAAGTAGCGCCGGGTTGTCAGGCTTATCT
TTCAATGCTGCTATCGAGTCATTAACCGCTTTGTTTGCATCGTCTGCTGGCTTCTTGAGCGTTTGAGCCA
CCGCATCTAAGTCTGCGATATCGGTTCCTTTCGTAAATCCAGAGAAGTTACTCA

Protein Sequence
>NP_857922.1 type III secretion protein (plasmid) [Yersinia pestis]
MSNFSGFTKGTDIADLDAVAQTLKKPADDANKAVNDSIAALKDKPDNPALLADLQHSINKWSVIYNINST
IVRSMKDLMQGILQKFP

Molecule Role Protective antigen
Molecule Role Annotation Modified YscF antigens were able to partially protect immunized mice at various levels against lethal challenge with Y. pestis KIM 1001 strain (Wang et al., 2008).
Related Vaccines(s) Y. pestis DNA vaccine YscF-2
References