VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Lef

Gene Name Lef
Sequence Strain (Species/Organism) Bacillus anthracis str. 'Ames Ancestor'
VO ID VO_0010873
NCBI Gene ID 2820148
NCBI Protein GI 47566484
Locus Tag GBAA_pXO1_0172
Genbank Accession AE017336
Protein Accession YP_016503
3D structure: PDB ID 1J7N
Other Database IDs CDD:285037
CDD:286266
CDD:238144
Taxonomy ID 261594
Plasmid No pXO1
Gene Starting Position 149356
Gene Ending Position 151785
Gene Strand (Orientation) -
Protein Name lethal factor
Protein pI 5.69
Protein Weight 89799.18
Protein Length 809
Protein Note Anthrax toxin lethal factor, N- and C-terminal domain; pfam07737
DNA Sequence
>NC_007322.2:149356-151785 Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence
CTTATGAGTTAATAATGAACTTAATCTGATCGTTAATAAATTGGAAAGTTTTCGGAGCATTTTTTTGAAC
TTTTAAACGTTCAGCATGGTCCGTAGAATGCATTAACCTAAAGGCTTCTGCAAAAAATTCCGCTTCATTT
GTTCTCCCATACGAAGTTAAATTACTCCCTTCTTCCTTAAAAATATCAATGAATTTTTTAGAATTTGTAA
CTAAATCAGATTGGTTCTTATCTAATAGATATCCAGCATAATCATCCACAGCATGTCCAAATTCGTGTAT
AAAACCCTCACTATCATTCCTTAATTCTACACCTTTTGAAGGTCCATGGAGTAATATAGAACGGGATTCT
GGAACATATAACCCTTTTGAATGAACTTGCTCATATATCTCATCTTGATGTGTATATTGTTCAGCTATAT
TAGGGAGAGTAATATCGGTAAAAACAAATCTTCCATTACCATCAACTAAGTAATTTGTTACCTTTTTTAT
AAGATCACTTTGAATATTATTTTTCCATTCATTCAATATTAAATAAGCACTTTCTACAATATTGGATGCA
TATCTATTATGCACGTTGAATGTAATAAGCTTTGTATATTTTGGTAACCCTAATGCTTTATTCCATTCCT
GATTTATATTTAACTGTGCTTCTTGAATTTTTGTATCTATTTTACTCTTTGGCACTACTTTCGCATCAAT
CCTTATATATTCTTTTTCGGATTGCTTAATTATTTGTACATCCTTTATTTCCAGACCGATGTTTCTTTGT
AATATAAGCTTTCCATTTTCTAAATATCCTGCTCGAGTATCTGGTGATAATTGGATTCTCCATTTCAAAC
GCTCATTATCTAATGCAGGCCTTTCATTTATATCAACAATCATATAGTTACTAGAAATACTATATTTGAA
ATTTTTTTTGAATTCATTGAAAATACCTCTATTAATTTTAGTATTATCAGTGGAATCAACTAAATCCGCA
CCTAGGGTTGCTGTAAGGTTATTGATATTCATATTTTCATACAAATAAATTTTATTGTACAAGGTACTTC
CAATGGATTGATGTAATAAAGCATCAATATTTTGAATATCCCTTTTATACTGCTTTCTTACATCAAGATT
AATTGACGGACTATCAATTAACCCTCCTGTATCTTGCAACCTTTGATTAATATCATATGGTTGAATATCA
AGTTTCAGCTTTTTTAAAAACTCTTTTTCTTTTTCAGATAAAGGATTACTACTATCCACCTGTATTCTAT
TTAAAAGCTCTTTTTCTTCTTCAGATAAAGAATCACGAATATCAATTTGTAGCTTTTTTAAAAACTCTTT
TTCCTCAGTAGATAAAAAATCACTACTATCAATTTGTATTCTTTTTAGAAGCTCTTTTTCTTCTTGAGAT
AAAGAATGAATTATGTCATCTTTCTTTGGCTCAATAGGAATCTGCAGCTTTTTTAAAAGTCCTCTTCCTT
CTTCAGATAAAGAATCGCTCCAGTGTTGATAGTGCTGTTTTATCTTTTCCCATTTTTCATATCTTGCCAG
CATCCGTTGATCTTTAAGTTCTTCCAAGGATAGATTTATTTCTTGTTCGTTAAATTTATCCATGTAATTA
AAAGCTTCCGGTGCATAAAGCTGTAAAACATCACGATGCTGTGGCTCGATATAATATGCAAAAGCTTTCG
CAAATACTTCTTGTACCTCATTGCTATTTTGTTCCAAGAATTCTACAGAAAAGTCTGTGGGATGTTCCTT
AAGCTGATTAGTAAATAAAAGATCTTGTCCATCTGAATCAGATGCATTTTTAATGGTATTTAATACATCT
AAAAATTTCTGATATGGTTGATTAATTTTACTTAAAATATCCCTTGATAATATCTTACCTATTTCATAAT
AAACGTTCAGTGCCTTTTCAGTATTTTCTACATAATCTTCCGAAGATTGGATTACAAGTACGGGTTCATA
TCCTTCTTTTGCATATACATAATGTTCATGTAATAAAGCATCTTTCCCATAAATGTCTTTTATTTTTTTC
TTATCTTCAGATAATGCTTCTAAAGATATATGTTTTGTAATATCACCATCCACAATATATATCTTTCCTC
CAATTGCTTTATACATCTCTAAAACATCAGATGGTACTTTCTCAAGTAGCTTTTCTGCTGCCTCTTTTTT
AACAGCTTCCTCCCCTTTTACTTCTATTTTTACAATGTGTTTCATGATTTCCTTTAAATGCTCTTCCTGT
GTTTTATTTCGTTCTTCATCTTTTCTCTTATTCTCATCTTTATTTTTCTCTTTCTCTTTTACGTGCATAC
CTACATCACCATGACCGCCCGCCCCCTGTACAAGGGGGATAAAGACGGGACCACTCAAAGTAATTGCTGT
TACTAAACATGACATACTAATTACTTTTATAAATTCTTTTTTTATATTCA

Protein Sequence
>YP_016503.2 lethal factor (plasmid) [Bacillus anthracis str. 'Ames Ancestor']
MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLK
EIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDI
YGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTI
KNASDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKF
NEQEINLSLEELKDQRMLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKE
LLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD
INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDS
TDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGL
EIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVE
SAYLILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSIL
LHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFF
AEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS

Molecule Role Protective antigen
Related Vaccines(s) B. anthracis DNA vaccine LF pDNA encoding LF , pCLF4
References