VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

YopH from Y. pestis strain: CO92, biovar: Orientalis

Gene Name YopH from Y. pestis strain: CO92, biovar: Orientalis
Sequence Strain (Species/Organism) Yersinia pestis CO92
VO ID VO_0012359
NCBI Gene ID 1172712
NCBI Protein GI 16082755
Locus Tag YPCD1.67c
Genbank Accession AL117189
Protein Accession NP_395201
Taxonomy ID 214092
Plasmid No pCD1
Gene Starting Position 47121
Gene Ending Position 48527
Gene Strand (Orientation) -
Protein Name putative secreted protein-tyrosine phosphatase
Protein pI 8.84
Protein Weight 47198.12
Protein Length 468
DNA Sequence
>NC_003131.1:47121-48527 Yersinia pestis CO92 plasmid pCD1, complete sequence
ATTAGCTATTTAATAATGGTCGCCCTTGTCCTTCAGCCAACTTAATCAGAACATCAAGTTGCTCATCTTT
TTGTACCATAATACCATTTCTTTGTACTCGCATTTGGCTGACCATATCTTCTACGCTTAACTGACTATTA
CGACTATCATTCATGCACATTGCGCCAATCAGTTGCGCAGTACGGCCAACACCCGCACGGCAATGTATTA
CCGGCCGTAATTTGGAGTCATCTCCTACCGCTGAACTTCCTTTGCTTTCATACATATTGCGTTTTGTTTC
TGCTGTTTGATCTACCAGTGAAGCGAGTGCCTTGGTAACTTCAGAGCTGACTGCGGTCTGATCGGGCCAA
TTGCCAACATGAACCACAGGAACAGAGATTGTTTTTTGACCCGCTTCACGAATCGTTAAAGTATACATAT
CTGCCATAATCCCGTCACCGAGACCAACTTGCTGAGTCATTTTAGACTCTACAGTGATACTGCCATAGGT
ACCACTCTGGCGGAAATAATCTGGCATACCGAATCTTTGATTGGCTATCTCAGAACTGGACGCTAAAACA
GCCAACACTGGCGTTCGGTTTTCTGCCAGCATACGGAAATGGCTTTCAAGTTGAGATTGTAGCGGATACT
GGCACGCTATGGTACGAGTGTTACCGACCTGGATGTAATTGGCATTAAGATCGGCGCGTACTGCGGTTTG
CCGACAGCATTGAATATCTCTAAATCGGTTTAGCTTTTCACCGCCGCAGGCTTGTAAGTAACGCGGATCA
TTCGTTGCTGGCGCCAGCGTATTGCGCAATGTGGTGAGGCGGCTGCTGAGTTCTGCGCGCGCTTCTGGGC
CATAAGGAGAAACAGTGCTTGGTGCGGTGGCTCTGGCTTCGCCAGCCCCGTGATGGCCAGAAGTGTGTGG
TCGTTCACGCGGTGGCAACGGTGGAGTTCTGGGGTCTAGATGTGAACGCAGTCCTTCACGCACCGGGGTT
CCCGGTGCGTGAAGGGCTGAATGTGAATGAGATGATACATGCCCCCTCGCTCCCGACTCTTGTCGCAATG
CGGCCTCCAACAGCACTTTGGCGTCTTGTAGTGTCATTTGGTCACTACGTAAACTGACAAGTACACTATT
ACCATTGCCGACACTTCTTAAGTCATAATTATTCAAATTATGCTTTACCGTACTTTGCAATAGCTTAGCG
GTATCTTCTTGAGTTAGAACAACATTTGCTACGTGGCTTAGTACAGTTTGAGCAAATACTTTTTCTGACT
CTCTGGCTCCACTGGCTATGGTCAAACCTTGAAAGGTAGTTTCTTTATTGGCAGCAACGTTACCTCTTAA
TTTCCCGGTACAATCACCGCTCTCTTGCTGCACCAATCGAGATACCTGACGATGAAGATCGCTTAATGAT
AAGTTCA

Protein Sequence
>NP_395201.1 putative secreted protein-tyrosine phosphatase (plasmid) [Yersinia pestis CO92]
MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIASGARESEKVFAQTVLSHVANVVLTQ
EDTAKLLQSTVKHNLNNYDLRSVGNGNSVLVSLRSDQMTLQDAKVLLEAALRQESGARGHVSSHSHSALH
APGTPVREGLRSHLDPRTPPLPPRERPHTSGHHGAGEARATAPSTVSPYGPEARAELSSRLTTLRNTLAP
ATNDPRYLQACGGEKLNRFRDIQCCRQTAVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAENRTP
VLAVLASSSEIANQRFGMPDYFRQSGTYGSITVESKMTQQVGLGDGIMADMYTLTIREAGQKTISVPVVH
VGNWPDQTAVSSEVTKALASLVDQTAETKRNMYESKGSSAVGDDSKLRPVIHCRAGVGRTAQLIGAMCMN
DSRNSQLSVEDMVSQMRVQRNGIMVQKDEQLDVLIKLAEGQGRPLLNS

Molecule Role Protective antigen
Molecule Role Annotation Study evaluated the humoral immune response of mice that survived lethal Y. pestis aerosol challenge after antibiotic treatment. Results indicated that one of the predominant antibody response of mice surviving pneumonic plague after treatment with antibiotics was to yopH (Benner et al., 1999).
Additional Molecule Role Virmugen
Additional Molecule Role Annotation A yopH mutant is highly attenuated in mice and induced significant protection from challenge with wild type Y. pestis (Bubeck and Dube, 2007).
Related Vaccines(s) Yersinia pestis yopH mutant vaccine
References