VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

M2 from Influenza A virus (A/Puerto Rico/8/34(H1N1))

Gene Name M2 from Influenza A virus (A/Puerto Rico/8/34(H1N1))
Sequence Strain (Species/Organism) Influenza A virus (A/Puerto Rico/8/1934(H1N1))
VO ID VO_0011119
NCBI Gene ID 956528
NCBI Protein GI 56583270
Locus Tag FLUAVs7gp2
Genbank Accession V01099
Protein Accession NP_040979
3D structure: PDB ID 3BKD
Taxonomy ID 211044
Gene Starting Position 25
Gene Ending Position 1006
Gene Strand (Orientation) +
Protein Name matrix protein 2
Protein pI 5.72
Protein Weight 10647.4
Protein Length 97
DNA Sequence
>NC_002016.1:25-1006 Influenza A virus (A/Puerto Rico/8/1934(H1N1)) segment 7, complete sequence
GATGAGTCTTCTAACCGAGGTCGAAACGTACGTTCTCTCTATCATCCCGTCAGGCCCCCTCAAAGCCGAG
ATCGCACAGAGACTTGAAGATGTCTTTGCAGGGAAGAACACCGATCTTGAGGTTCTCATGGAATGGCTAA
AGACAAGACCAATCCTGTCACCTCTGACTAAGGGGATTTTAGGATTTGTGTTCACGCTCACCGTGCCCAG
TGAGCGAGGACTGCAGCGTAGACGCTTTGTCCAAAATGCCCTTAATGGGAACGGGGATCCAAATAACATG
GACAAAGCAGTTAAACTGTATAGGAAGCTCAAGAGGGAGATAACATTCCATGGGGCCAAAGAAATCTCAC
TCAGTTATTCTGCTGGTGCACTTGCCAGTTGTATGGGCCTCATATACAACAGGATGGGGGCTGTGACCAC
TGAAGTGGCATTTGGCCTGGTATGTGCAACCTGTGAACAGATTGCTGACTCCCAGCATCGGTCTCATAGG
CAAATGGTGACAACAACCAACCCACTAATCAGACATGAGAACAGAATGGTTTTAGCCAGCACTACAGCTA
AGGCTATGGAGCAAATGGCTGGATCGAGTGAGCAAGCAGCAGAGGCCATGGAGGTTGCTAGTCAGGCTAG
GCAAATGGTGCAAGCGATGAGAACCATTGGGACTCATCCTAGCTCCAGTGCTGGTCTGAAAAATGATCTT
CTTGAAAATTTGCAGGCCTATCAGAAACGAATGGGGGTGCAGATGCAACGGTTCAAGTGATCCTCTCGCT
ATTGCCGCAAATATCATTGGGATCTTGCACTTGATATTGTGGATTCTTGATCGTCTTTTTTTCAAATGCA
TTTACCGTCGCTTTAAATACGGACTGAAAGGAGGGCCTTCTACGGAAGGAGTGCCAAAGTCTATGAGGGA
AGAATATCGAAAGGAACAGCAGAGTGCTGTGGATGCTGACGATGGTCATTTTGTCAGCATAGAGCTGGAG
TA

Protein Sequence
>NP_040979.2 matrix protein 2 [Influenza A virus (A/Puerto Rico/8/1934(H1N1))]
MSLLTEVETPIRNEWGCRCNGSSDPLAIAANIIGILHLILWILDRLFFKCIYRRFKYGLKGGPSTEGVPK
SMREEYRKEQQSAVDADDGHFVSIELE

Molecule Role Protective antigen
Molecule Role Annotation A targeted fusion protein based on the CTA1-DD adjuvant and containing tandem repeats of the matrix protein 2 (M2e) ectodomain epitope derived from Influenza A virus (A/Puerto Rico/8/34(H1N1)), CTA1-3M2e-DD, confers strong protective immunity against a potentially lethal challenge infection with influenza virus in mice. The formulation was highly effective for mucosal immunizations and promoted high M2e-specific serum IgG and mucosal IgA antibody titers and an hitherto unknown anti-M2e CD4 T cell immunity (Eliasson et al., 2008).
Additional Molecule Role Virmugen
Additional Molecule Role Annotation Mutant influenza virus that lacks the transmembrane and cytoplasmic tail domains of M2 (M2 knockout [M2KO]) from Influenza A virus (A/Puerto Rico/8/34(H1N1)) is attenuated in both cell culture and mice. Mice intranasally vaccinated with M2KO virus developed protective immune responses and survived a lethal challenge with the wild-type virus, suggesting that the M2KO virus has potential as a live attenuated vaccine (Watanabe et al., 2009).
Related Vaccines(s) BPZE1- FHA (H1N1/PR8 influenza A virus) , Influenza virus CTA1-3M2e-DD protein vaccine , Influenza virus DNA vaccine M2-DNA/M2-Ad , Influenza virus DNA vaccine pDNA encoding M2 and NP , M2 mutant from Influenza A
References