VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ExbB

Gene Name ExbB
Sequence Strain (Species/Organism) Neisseria meningitidis MC58
VO ID VO_0011186
NCBI Gene ID 903370
NCBI Protein GI 15677575
Locus Tag NMB1729
Genbank Accession AE002098
Protein Accession NP_274732
Taxonomy ID 122586
Gene Starting Position 1812128
Gene Ending Position 1812790
Gene Strand (Orientation) -
Protein Name biopolymer transport protein
Protein pI 9.81
Protein Weight 22358.4
Protein Length 220
Protein Note identified by similarity to EGAD:145333; match to protein family HMM PF01618
DNA Sequence
>NC_003112.2:1812128-1812790 Neisseria meningitidis MC58 chromosome, complete genome
ATCAGCTATCCTTTTGATTAAGCAGGCGGACGTGCAAATCGTGCGCCATCGCATCCAAATCCTGGGTCAG
TATTTTTGTGCCGCGATTGAGGAAGTTGTATGCCAACACCGCCGGAATCGCCACGAACAAACCCGCCGCC
GTCGCCACCAGTGCCTCGCCAATCGGGCCGGCAACCGCCGCAATACTCATCTGCCCGCTTTGCCCGATAT
TGATCAGGGCGTGGTAAATCCCCCAAACCGTGCCGAACAGCCCGATAAACGGCGCGGTCGCGCCGATGGA
GGCAAGCGCGGTCATCCCGTAATCAAACCGGCGCATAATCTGCGCCATACTGTTGCGGATTTGAATGACC
AAATACTCGTTCAACGGCAAAGCCTGCGCCAGTTCGGACGCTTCGTTTCGGCGGTAGTTGCGGTAAGACT
GCAATGCCTCTTGCGCCAGTTTGGACAAAGGCGCATCGACGGCGCGCACTTTTTCGACCGCGTCGTTCAG
CGACAAAGTATCGCGCATATGCCGTTTGACGGCGGCATTCCCTTTGCGCGCCCGATACAGCTTGATGCAG
CGCAAGACAACCAAACACCACGTTACGATACTCATCAACAGCATCAACACAAACACACCAATCAGGACGG
GATCGCCCGATTCAAACACTAATTTCAAATTCA

Protein Sequence
>NP_274732.1 biopolymer transport protein [Neisseria meningitidis MC58]
MNLKLVFESGDPVLIGVFVLMLLMSIVTWCLVVLRCIKLYRARKGNAAVKRHMRDTLSLNDAVEKVRAVD
APLSKLAQEALQSYRNYRRNEASELAQALPLNEYLVIQIRNSMAQIMRRFDYGMTALASIGATAPFIGLF
GTVWGIYHALINIGQSGQMSIAAVAGPIGEALVATAAGLFVAIPAVLAYNFLNRGTKILTQDLDAMAHDL
HVRLLNQKDS

Molecule Role Protective antigen
Molecule Role Annotation A total of 11 meningococcal proteins that are necessary for establishing systemic infection were expressed as recombinant antigens and assessed for their ability to protect mice against live bacterial challenge against N. meningitidis; ExbB, which is required for iron acquisition, elicited protective immunity (Sun et al., 2005).
Related Vaccines(s) N. meningitidis ExbB Protein Vaccine
References