VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

GltX

Gene Name GltX
Sequence Strain (Species/Organism) Streptococcus pneumoniae TIGR4
VO ID VO_0011201
NCBI Gene ID 931970
NCBI Protein GI WP_000031087
Locus Tag SP_2069
Genbank Accession AE005672
Protein Accession NP_346492
Other Database IDs CDD:234953
Taxonomy ID 1313
Gene Starting Position 1976626
Gene Ending Position 1978086
Gene Strand (Orientation) -
Protein Name glutamate--tRNA ligase
Protein pI 4.67
Protein Weight 54587.89
Protein Length 560
Protein Note glutamyl-tRNA synthetase; Reviewed; PRK01406
DNA Sequence
>NC_003028.3:1976626-1978086 Streptococcus pneumoniae TIGR4, complete genome
TTTATTTAGAGATTTCTTTTAGCATGTTTTCGATATGCTGAATTGATTTTTCACGTCCAAGCAAGAAAAT
TGTATCTGGTAATTCTGGCCCATGCATTTCGCCTGAAACTGCGATACGAATAGGCATGAAAAGATTTTTC
CCTTTAATACCTGTTTCTTTTTGGACTGCTTTAATTTGTGGGAAGATATTTTCTGTCACAAATTCATCAT
CTGTCATCGCTTCAAGTTTTGCTTTGAATGCTTCAAGAACTGTTGGAACTGTTTCACCCGTCATGACTTC
GCGCTCTGCTTCTGTCAATTCTGGGAAATCTGAGAAGAAAAGATCTGTCAATGGGATAATCTCATCTACT
GATTTCATTTGTGGTTTATAGAGCTCAACTAATTTTTCAGCCTTGTCAGTCAAACGGCCTGCTTCCTCTA
AGAATGGTTTTGCCATTTCAAAGATGGTTTCAAGGTCTGCATTCTTGATATAATCATTGCTCATCCAGTC
TAGTTTTTTCTGATCAAAGGCTGCTGGTGACTTGCTGAGGCGGTTTTCATCAAAAAGTTTAATGAATTCT
TCACGAGAGAAAATCTCATCTTCACCACCTGGGTTCCAACCAAGAAGAGCAATAAAGTTAAAGACTGCTT
CTGGAAGGTAACCTTTCTTTCGGTAATCTTCGATAAATTGAAGTGTATTAGTATCACGTTTAGATAACTT
CTTACCAGTTTCAGAGTTGATAATCAAGGTCATGTGACCGAACTCTGGAGCTTCCCAACCAAGAGCTTCA
TAGACCATAAGCTGTTTTGGTGTATTAGCAATATGGTCATCTCCACGGATAACATGAGAGATTTGCATAT
CGTGGTCATCGATAACAACGGCAAAGTTGTAAGTTGGGTAACCGTCTTTCTTTTGGATAACCCAGTCACC
ACCGATATTGCCACCTTCAAATTCGATATCGCCTTTGACCATATCATGCCACTTGTAGATACCTGACTCA
TTGACAGCCAAACGAACAGTTGGGATGATCCCTGCTGCTTCACGTTCTGCGATGTAAGCTGCTTTTTCTT
CTTCACTCATACCAAGGTATTCATTGATGTAGCGTGGTGTTTCGCCAGCTACTTCTTGGCGTTCGCGTTC
AGCTGCCAACTCTTCTTCTGTAACGTAAGATTTATAGGCTTTTCCTTCAGCTAATAGTTGGTCAATATAT
TTTTGATACAAGTCCAAACGCTCAGACTGGCGATAATTCTCATGTGATTCTGGACTTTCATCCCAATCCA
TGCCTAACCAGCGAAGGTTTTCAAGTTGTGAACGTTCACCATCCTCGACATGGCGTTTACGGTCAGTATC
TTCGATACGGATGAGAAATGTTCCACCATGATGGCGCGCATACAAGTAATTAAACAATGCTGTACGAGCA
TTTCCGATGTGTAGTAGTCCTGTTGGACTTGGTGCGTAACGTACGCGGATATCTTTTGACA
Protein Sequence
>WP_000031087.1 glutamate--tRNA ligase [Streptococcus pneumoniae]
MSKDIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGTFLIRIEDTDRKRHVEDGERSQLENLRWLGMDW
DESPESHENYRQSERLDLYQKYIDQLLAEGKAYKSYVTEEELAAERERQEVAGETPRYINEYLGMSEEEK
AAYIAEREAAGIIPTVRLAVNESGIYKWHDMVKGDIEFEGGNIGGDWVIQKKDGYPTYNFAVVIDDHDMQ
ISHVIRGDDHIANTPKQLMVYEALGWEAPEFGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYLPEAV
FNFIALLGWNPGGEDEIFSREEFIKLFDENRLSKSPAAFDQKKLDWMSNDYIKNADLETIFEMAKPFLEE
AGRLTDKAEKLVELYKPQMKSVDEIIPLTDLFFSDFPELTEAEREVMTGETVPTVLEAFKAKLEAMTDDE
FVTENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDTIFLLGREKSIQHIENMLKEISK
Molecule Role Protective antigen
Molecule Role Annotation Glutamyl tRNA synthetase (GtS) has been found to be among the Streptococcus pneumoniae cell wall-derived proteins that have age-dependent immunogenicity in children. Here, GtS was cloned, expressed, and purified and then was used to immunize 7-week-old BALB/c OlaHsd mice. Thirty-nine percent of rGtS-immunized mice survived a lethal bacterial challenge, whereas no control mice survived (Mizrachi et al., 2007).
Related Vaccines(s) S. pneumoniae GtS Protein Vaccine
References