VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

NcDG1

Gene Name NcDG1
Sequence Strain (Species/Organism) Neospora caninum
VO ID VO_0011202
NCBI Protein GI 2149142
Taxonomy ID 29176
Gene Strand (Orientation) ?
Protein Name dense granule protein
Protein pI 4.28
Protein Weight 20771.11
Protein Length 275
Protein Sequence
>AAC47661.1 dense granule protein [Neospora caninum]
MARQATFIVALCVCGLAIAGLPRLASAGDLATEQHEGDIGYGVRAYAGVSNYDGDDDAAGNPVDSDVTDD
AITDGEWPRVVSGQKPHTTQKGSLIKKLAVPVVGALTSYLVADRVLPELTSAEEEGTESIPGKKRVKTAV
GIAALVAAAAFAGLGLARTFRHFVPKKSKTVASEDSALGNSEEQYVEGTVNGSSDPEQERAGGPLIPEGD
EQEVDTE

Molecule Role Protective antigen
Molecule Role Annotation Separate groups of gerbils were immunized with purified recombinant proteins singly or in combinations and animals were then challenged with N. caninum. The protective efficacy of each vaccination was determined by assessing animal survival rate. The highest protection efficacy was observed for combined vaccination with NcSRS2 and NcDG1 (67.5% survival) compared to control (17.4% survival). Vaccination with NcDG1 alone elicited 62.5% survival in the challenge model (Cho et al., 2005).
Related Vaccines(s) N. caninum NcDG1 protein vaccine
References