VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Gnd

Gene Name Gnd
Sequence Strain (Species/Organism) Streptococcus pneumoniae D39
VO ID VO_0011206
NCBI Gene ID 4441177
NCBI Protein GI WP_000158781
Locus Tag SPD_0343
Genbank Accession CP000410
Protein Accession YP_815856
Other Database IDs CDD:236453
Taxonomy ID 1301
Gene Starting Position 347261
Gene Ending Position 348685
Gene Strand (Orientation) +
Protein Name NADP-dependent phosphogluconate dehydrogenase
Protein pI 4.58
Protein Weight 51871.44
Protein Length 574
Protein Note 6-phosphogluconate dehydrogenase; Validated
DNA Sequence
>NC_008533.1:347261-348685 Streptococcus pneumoniae D39, complete genome
AATGACAAAAGCTAACTTTGGTGTCGTAGGTATGGCCGTAATGGGTCGTAACCTTGCCCTTAATATTGAA
TCACGTGGTTACACAGTTGCTATCTACAACCGTAGTAAAGAAAAAACGGAAGATGTGATTGCTTGCCATC
CTGAAAAGAATTTTGTACCAAGCTATGACGTTGAAAGTTTTGTAAACTCAATCGAAAAACCTCGTCGTAT
CATGCTGATGGTTCAAGCTGGACCTGGTACAGATGCTACTATTCAAGCCCTTCTTCCGCACCTTGACAAG
GGTGATATCTTGATTGACGGTGGAAATACTTTCTACAAAGATACCATCCGTCGTAATGAAGAATTGGCAA
ACTCTGGTATCAACTTTATCGGTACTGGGGTTTCTGGTGGTGAAAAAGGTGCCCTTGAAGGTCCTTCTAT
CATGCCTGGTGGACAAAAAGAAGCCTACGAATTGGTTGCGGATGTTCTTGAAGAAATCTCAGCTAAAGCA
CCAGAAGATGGCAAACCATGTGTGACTTACATCGGTCCTGATGGAGCTGGTCACTATGTGAAAATGGTTC
ACAATGGTATTGAGTACGGTGATATGCAATTGATCGCAGAAAGCTATGACTTGATGCAACACTTGCTAGG
CCTTTCTGCAGAAGATATGGCTGAAATCTTTACTGAGTGGAACAAGGGTGAATTAGACAGCTACTTGATT
GAAATCACAGCTGATATCTTGAGCCGTAAAGACGATGAAGGCCAAGATGGACCAATCGTAGACTACATCC
TTGATGCTGCAGGTAACAAGGGAACTGGTAAATGGACTAGCCAATCATCTCTTGACCTTGGTGTACCATT
GTCACTGATTACTGAGTCAGTGTTTGCACGCTACATTTCAACTTACAAAGAAGAACGTGTACATGCTAGC
AAGGTGCTTCCAAAACCAGCTGCCTTCAACTTTGAAGGAGACAAGGCTGAATTGATTGAAAAGATCCGTC
AAGCCCTTTACTTCTCAAAAATCATTTCATACGCACAAGGATTTGCTCAATTGCGTGTAGCCTCTAAAGA
AAACAACTGGAACTTGCCATTTGCAGATATCGCATCTATCTGGCGTGATGGCTGTATCATCCGTTCTCGT
TTCTTGCAAAAGATTACAGATGCTTACAACCGCGATGCAGATCTTGCCAACCTTCTTTTGGACGAGTACT
TCTTGGATGTTACTGCTAAGTACCAACAAGCAGTACGTGATATCGTAGCTCTTGCGGTTCAAGCAGGTGT
GCCAGTGCCAACTTTCTCAGCAGCTATTACTTACTTTGATAGCTACCGTTCAGCTGACCTTCCAGCTAAC
TTGATCCAAGCACAACGTGACTACTTTGGTGCTCACACTTACCAACGTAAAGACAAAGAAGGAACCTTCC
ACTACTCTTGGTATGACGAAAAATA
Protein Sequence
>WP_000158781.1 MULTISPECIES: NADP-dependent phosphogluconate dehydrogenase [Streptococcus]
MTKANFGVVGMAVMGRNLALNIESRGYTVAIYNRSKEKTEDVIACHPEKNFVPSYDVESFVNSIEKPRRI
MLMVQAGPGTDATIQALLPHLDKGDILIDGGNTFYKDTIRRNEELANSGINFIGTGVSGGEKGALEGPSI
MPGGQKEAYELVADVLEEISAKAPEDGKPCVTYIGPDGAGHYVKMVHNGIEYGDMQLIAESYDLMQHLLG
LSAEDMAEIFTEWNKGELDSYLIEITADILSRKDDEGQDGPIVDYILDAAGNKGTGKWTSQSSLDLGVPL
SLITESVFARYISTYKEERVHASKVLPKPAAFNFEGDKAELIEKIRQALYFSKIISYAQGFAQLRVASKE
NNWNLPFADIASIWRDGCIIRSRFLQKITDAYNRDADLANLLLDEYFLDVTAKYQQAVRDIVALAVQAGV
PVPTFSAAITYFDSYRSADLPANLIQAQRDYFGAHTYQRKDKEGTFHYSWYDEK
Molecule Role Protective antigen
Molecule Role Annotation BALB/c mice were immunized with recombinant 6-Phosphogluconate dehydrogenase (r6PGD) and boosted after 3 weeks. Immunized mice were challenged intranasally with a lethal dose of S. pneumoniae. Immunization of mice with r6PGD protected 60% (P < 0.001) of mice for 5 days and 40% (P < 0.05) of the mice for 21 days following intranasal lethal challenge (Daniely et al., 2006).
Related Vaccines(s) S. pneumoniae 6PGD Protein Vaccine
References