VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

msp3

Gene Name msp3
Sequence Strain (Species/Organism) Plasmodium falciparum
VO ID VO_0011220
NCBI Protein GI 113207288
Other Database IDs CDD:284533
InterPro: IPR010784
UniProtKB/TrEMBL: Q0KGB6
Taxonomy ID 5833
Gene Strand (Orientation) ?
Protein Name merozoite surface protein 3
Protein pI 4.26
Protein Weight 33643.59
Protein Length 383
Protein Note Merozoite surface protein (SPAM); pfam07133
Protein Sequence
>CAJ44236.1 merozoite surface protein 3, partial [Plasmodium falciparum]
SKEIVKKYNLNLRNAILNNNSQIENEENVNTTITGNDFSGGEFLWPGYTEELKAKKASEDAEKAANDAEN
ASKEAEEAAKEAVNLKESDKSYTKAKEACTAASKAKKAVETALKAKDDAEKSSKADSISTKTKEYAEKAK
NAYEKAKNAYQKANQAVLKAKEASSYDYILGWEFGGGVPEHKKEENMLSHLYVSSKDKENISKENDDVLD
EKEEEAEETEEEELEEKNEEETESEISEDEEEEEEEEEKEEENDKKKEQEKEQSNENNDQKKDMEAQNLI
SKNQNNNEKNVKEAAESIMKTLAG

Molecule Role Protective antigen
Molecule Role Annotation Immunization with a recombinant yeast-expressed Plasmodium falciparum merozoite surface protein 3 (MSP3) protected Aotus nancymai monkeys against a virulent challenge infection (Tsai et al., 2009).
Related Vaccines(s) P. falciparum MSP3 Protein Subunit Vaccine
References