VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

UL44

Gene Name UL44
Sequence Strain (Species/Organism) Suid alphaherpesvirus 1
VO ID VO_0011239
NCBI Gene ID 2952505
NCBI Protein GI 51557513
Locus Tag SuHV1_gp30
Genbank Accession BK001744
Protein Accession YP_068347
Taxonomy ID 10345
Gene Starting Position 53985
Gene Ending Position 55504
Gene Strand (Orientation) +
Protein Name envelope glycoprotein C
Protein pI 6.98
Protein Weight 45878.36
Protein Length 479
Protein Note envelope glycoprotein C; the Herpesviridae are non-segmented dsDNA viruses with genomes ranging from 120-230kbp; although herpes viruses vary greatly in sequence identity and homology, they all share four common elements: an envelope, a tegument which is composed of viral enzymes, a capsid of 162 capsomers, and a core composed of genomic DNA;virion envelope glycoproteins bind to cellular receptors; the nonessential glycoprotein gC interacts with cell surface proteoglycans, whereas the essential glycoprotein gD is involved in stable secondary attachment
DNA Sequence
>NC_006151.1:53985-55504 Suid herpesvirus 1, complete genome
TTTTAAAACCGCGATGGGGGGACGGGGGGCCATTCGCACGCGCCATGGCCTCGCTCGCGCGTGCGATGCT
CGCTCTGCTGGCGCTCTACGCGGCGGCCATCGCCGCGGCGCCGTCGACCACGACGGCGCTCGACACGACG
CCCAACGGGGGCGGCGGCGGCAACAGCAGCGAGGGAGAACTCTCGCCCTCTCCGCCCCCGACCCCCGCGC
CCGCCTCGCCCGAGGCGGGCGCGGTCTCGACGCCCCCGGTCCCGCCGCCCTCGGTCTCGCGCAGGAAGCC
CCCGCGGAACAACAACCGGACGCGCGTCCACGGCGACAAGGCCACCGCGCACGGGCGCAAGCGCATCGTG
TGCCGGGAGCGGCTGTTCTCGGCGCGGGTGGGGGACGCGGTCAGCTTCGGGTGCGCCGTCTTCCCGCGCG
CCGGGGAGACCTTCGAGGTCCGCTTCTACCGCCGCGGGCGCTTCCGCTCGCCCGACGCCGACCCCGAGTA
CTTTGACGAGCCCCCGCGCCCGGAGCTCCCGCGGGAGCGGCTCCTCTTCAGCTCCGCCAACGCCTCCCTC
GCCCACGCGGACGCGCTCGCGCCCGTCGTCGTCGAGGGCGAGCGCGCGACCGTCGCCAACGTCTCGGGCG
AGGTGTCCGTGCGCGTGGCCGCGGCGGACGCCGAGACCGAGGGCGTCTACACGTGGCGCGTGCTGTCCGC
CAACGGCACCGAGGTCCGGAGCGCCAACGTCTCGCTCCTCCTGTACAGCCAGCCCGAGTTCGGCCTGAGC
GCGCCGCCCGTCCTCTTCGGTGAGCCCTTCCGGGCGGTGTGCGTCGTCCGCGACTACTACCCGCGGCGCA
GCGTGCGCCTGCGCTGGTTCGCGGACGAGCACCCGGTGGACGCCGCCTTCGTGACCAACAGCACCGTGGC
CGACGAGCTCGGGCGCCGCACGCGCGTCTCCGTGGTGAACGTGACGCGCGCGGACGTCCCGGGCCTCGCG
GCCGCGGACGCCGCGGACGCGCTCGCGCCGAGCCTGCGCTGCGAGGCCGTGTGGTACCGCGACAGCGTGG
CCTCGCAGCGCTTCTCCGAGGCCCTGCGCCCCCACGTCTACCACCCGGCGGCGGTCTCGGTGCGCTTCGT
CGAGGGCTTCGCCGTCTGCGACGGCCTCTGCGTGCCCCCGGAGGCGCGCCTCGCCTGGTCCGACCACGCC
GCCGACACCGTCTACCACCTCGGCGCCTGCGCGGAGCACCCCGGCCTGCTCAACGTGCGGAGCGCCCGCC
CGCTGTCGGACCTCGACGGGCCCGTCGACTACACCTGCCGCCTCGAGGGCCTGCCCTCGCAGCTGCCCGT
CTTCGAGGACACGCAGCGCTACGACGCCTCCCCCGCGTCCGTGAGCTGGCCCGTCGTGAGCAGCATGATC
GTCGTCATCGCCGGCATCGGGATCCTGGCCATCGTGCTGGTCATCATGGCGACGTGCGTCTACTACCGCC
GGGCGGGGCCGTGACGCCCCGCGCGTTCCCCCCCCACGTCGAATCAATAA

Protein Sequence
>YP_068347.1 envelope glycoprotein C [Suid alphaherpesvirus 1]
MASLARAMLALLALYAAAIAAAPSTTTALDTTPNGGGGGNSSEGELSPSPPPTPAPASPEAGAVSTPPVP
PPSVSRRKPPRNNNRTRVHGDKATAHGRKRIVCRERLFSARVGDAVSFGCAVFPRAGETFEVRFYRRGRF
RSPDADPEYFDEPPRPELPRERLLFSSANASLAHADALAPVVVEGERATVANVSGEVSVRVAAADAETEG
VYTWRVLSANGTEVRSANVSLLLYSQPEFGLSAPPVLFGEPFRAVCVVRDYYPRRSVRLRWFADEHPVDA
AFVTNSTVADELGRRTRVSVVNVTRADVPGLAAADAADALAPSLRCEAVWYRDSVASQRFSEALRPHVYH
PAAVSVRFVEGFAVCDGLCVPPEARLAWSDHAADTVYHLGACAEHPGLLNVRSARPLSDLDGPVDYTCRL
EGLPSQLPVFEDTQRYDASPASVSWPVVSSMIVVIAGIGILAIVLVIMATCVYYRRAGP

Molecule Role Protective antigen
Molecule Role Annotation A trial vaccine containing pseudorabies virus (PRV) glycoprotein gC as the main component showed excellent protection against virulent virus infection in pigs (Katayama et al., 1997).
Related Vaccines(s) Pseduorabies Subunit Glycoprotein C Vaccine
References