VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Hsp90

Gene Name Hsp90
Sequence Strain (Species/Organism) Plasmodium falciparum
VO ID VO_0011241
NCBI Protein GI 1093612
Other Database IDs CDD:240341
CDD:214643
CDD:238030
CDD:278607
Taxonomy ID 5833
Gene Strand (Orientation) ?
Protein pI 4.63
Protein Weight 82921.42
Protein Length 796
Protein Note heat shock protein 83 kDa (Hsp83); Provisional
Protein Sequence
>prf||2104278A heat shock protein 90
MSTETFAFNADIRQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESITDTQKLSAEPEFFIRIIPDK
TNNTLTIEDSGIGMTKNDLINNLGTIARSGTKAFMEAIQASGDISMIGQFGVGFYSAYLVADHVVVISKN
NDDEQYVWESAAGGSFTVTKDETNEKLGRGTKIILHLKEDQLEYLEEKRIKDLVKKHSEFISFPIKLYCE
RQNEKEITASEEEEEGEGEGEREGEEEEEEKKKKTGEDKNADESKEENEDEEKKEDNEEDDNKTDHPKVE
DVTEELENAEKKKKEKRKKKIHTVEHEWEELNKQKPLWMRKPEEVTNEEYASFYKSLTNDWEDHLAVKHF
SVEGQLEFKALLFIPKRAPFDMFENRKKRNNIKLYVRRVFIMDDCEEIIPEWLNFVKGVVDSEDLPLNIS
RESLQQNKILKVIKKNLIKKCLDMFSELAENKENYKKFYEQFSKNLKLGIHEDNANRTKITELLRFQTSK
SGDEMIGLKEYVDRMKENQKDIYYITGESINAVSNSPFLEALTKKGFEVIYMVDPIDEYAVQQLKDFDGK
KLKCCTKEGLDIDDSEEAKKDFETLKAEYEGLCKVIKDVLHEKVEKVVVGQRITDSPCVLVTSEFGWSAN
MERIMKAQALRDNSMTSYMLSKKIMEINARHPIISALKQKADADKSDKTVKDLIWLLFDTSLLTSGFALE
EPTTFSKRIHRMIKLGLSIDEEENNDIDLPPLEETVDATDSKMEEVD

Molecule Role Protective antigen
Molecule Role Annotation A monkey vaccination trial using a Plasmodium falciparum protein fraction containing antigens of 90-110 kDa is reported. Three monkeys out of five resisted a heavy challenge dose of highly virulent parasites. Hsp90 was found in the immunoprecipitates obtained with SERP antisera. Interestingly, the response to hsp90 correlated with protection, high antibody titres being found only in the protected monkeys (Bonnefoy et al., 1994).
Related Vaccines(s) P. falciparum Hsp90 Protein Subunit Vaccine
References