VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ORF2

Gene Name ORF2
Sequence Strain (Species/Organism) Porcine circovirus type 2
VO ID VO_0011243
NCBI Protein GI 78217439
Other Database IDs CDD:280582
Taxonomy ID 85708
Gene Strand (Orientation) ?
Protein Name ORF2
Protein pI 11.34
Protein Weight 26948.82
Protein Length 278
Protein Note Circovirus capsid protein; pfam02443
Protein Sequence
>ABB36795.1 ORF2 [Porcine circovirus 2]
MAYPRRRYRRRRHRPRSHLGQILRRRLWLLHPRHRYRWRRKNGIFNTRLSRTFGYTIKRTTVKTPSWAVD
MMRFNINDFLPPGGGSNPRSVPFEYYRIRKVKVEFWPCSPITQGDRGVGSSAVILDDNFVTKATALTYDP
YVNYSSRHTITQPFSYHSRYFTPKPVLDSTIDYFQPNNKRNQLWLRLQTAGNVDHVGLGTAFENSIYDQE
YNIRVTMYVQFREFNLKDPPLKP

Molecule Role Protective antigen
Molecule Role Annotation An open reading frame 2 plasmid (pORF2) and the capsid protein (Cap) of PCV2 were used as DNA and subunit vaccines, respectively. In FCM analysis, although pORF2 and Cap alone showed comparable efficacy in eliciting lymphoproliferative responses and Cap-specific CD4(+) T cells, pORF2 was superior to the Cap protein in triggering CD8(+) T cells. Following virus challenge, real-time PCR and histopathological analysis confirmed that only low viral DNA loads and mild microscopic lesions appeared in pORF2-immunized mice (Shen et al., 2008).
Related Vaccines(s) PCV2 DNA Vaccine encoding ORF2 Protein , PrV-PCV2-ORF2
References