VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

SP

Gene Name SP
Sequence Strain (Species/Organism) Leishmania major
VO ID VO_0011276
NCBI Protein GI 23168331
Other Database IDs CDD:299172
CDD:119398
Taxonomy ID 5664
Gene Strand (Orientation) ?
Protein Name signal peptidase type I
Protein pI 7.75
Protein Weight 18937.49
Protein Length 239
Protein Note The S24, S26 LexA/signal peptidase superfamily contains LexA-related and type I signal peptidase families. The S24 LexA protein domains include: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the...; cl10465
Protein Sequence
>AAN08877.1 signal peptidase type I [Leishmania major]
MREHINTLLSLRVRDVIQQVVTVGLFLSIVLVGWRAVAVGTNCEASIVVVLSGSMEPGYYRGDVLLLHHR
PEYPVTVGDIIVYTLPGQEIPIVHRVHRIHQRSEDGKKFYLTKGDNNVNDDRFLFRNGREWVEEGMIIGK
TYAYVPRIGYLTIMFNESKIIKYLALGLIGFFLLTTTDEM

Molecule Role Protective antigen
Molecule Role Annotation The potential protection of Lmjsp (Leishmania major signal peptidase) was evaluated in three different vaccination strategies (DNA/DNA, Protein/Protein and DNA/Protein), against L. major infection. We demonstrated that vaccination with SPase through all three mentioned strategies induced a parasite specific Th1 response and conferred partial protection against parasite challenge. However, our results indicated that DNA/DNA strategy developed more effective protective responses than the other two approaches and induced 81% reduction in L. major parasite load (Rafati et al., 2006).
Related Vaccines(s) L. major DNA Vaccine encoding SP
References