VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Rop2

Gene Name Rop2
Sequence Strain (Species/Organism) Toxoplasma gondii
VO ID VO_0011340
NCBI Protein GI 115299638
3D structure: PDB ID 2W1Z
Other Database IDs CDD:291215
CDD:304357
Taxonomy ID 5811
Gene Strand (Orientation) ?
Protein Name Rop2 protein
Protein pI 9.64
Protein Weight 28699.38
Protein Length 316
Protein Note Kinase-like; pfam14531
Protein Sequence
>ABI93795.1 Rop2 protein, partial [Toxoplasma gondii]
LRLLRGIKNQKQAKVHLRFIFPFDLVKDPKKRKMIRVRLDERDMWVLSRFFLYPRMQSNLQMLGDVLLSH
SSTHKSLVHHARLQLTLQLIRLLASLHHYGLVHADFQVSNILLDQRGGVFLTGFEHLVRDGASAVSPIGR
GFAPPETTAERMLPFGQHHPTLMTFAFDTWTLGLAIYWIWCADLPNTDDAALGGSEWIFRSCKNIPQPVR
ALLEGFLRYPKEDRLLPLQAMETPEYEQLRTELSAVLPLYQTDGEPA

Molecule Role Protective antigen
Molecule Role Annotation A study to examine the immunostimulatory properties of Leishmania infantum Hsp83 (83) to elicit humoral and cellular response against the Toxoplasma gondii Rop2 protein in an adjuvant-free vaccination system was conducted. Mice immunized with fusion Rop2-83 elicited a stronger humoral and cellular response in comparison to mice immunized with Rop2 alone, or a mix of LiHsp83 and Rop2. The fusion protein induced a Th1 type response, with predominance of specific IgG2a/IgG2c isotype and IFN-gamma secretions, whereas Rop2 alone or mixed with LiHsp83 produced a Th1/Th2 mixed response. Vaccination with fusion protein conferred a remarkable resistance against oral infection with ME49 cysts in C57BL/6 and C3H mice, in comparison to mice immunized with Rop2 alone or the protein mixture. Following lethal challenge, a significant survival rate was observed in Rop2-83 immunized Balb/c and C57BL/6 mice in comparison to control groups (Echeverria et al., 2006).
Related Vaccines(s) T. gondii DNA vaccine pcDNA3.1-SAG1-ROP2 , T. gondii Subunit Rop2-Hsp83 Fusion Protein Vaccine
References