VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

HBHA

Gene Name HBHA
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Ra
VO ID VO_0012373
NCBI Gene ID 5211814
NCBI Protein GI 148660242
Locus Tag MRA_0482
Genbank Accession CP000611
Protein Accession YP_001281765
Taxonomy ID 25177
Gene Starting Position 567106
Gene Ending Position 567705
Gene Strand (Orientation) +
Protein Name iron-regulated heparin binding hemagglutinin Hbha
Protein pI 9.84
Protein Weight 20541.79
Protein Length 199
DNA Sequence
>NC_009525.1:567106-567705 Mycobacterium tuberculosis H37Ra, complete genome
CATGGCTGAAAACTCGAACATTGATGACATCAAGGCTCCGTTGCTTGCCGCGCTTGGAGCGGCCGACCTG
GCCTTGGCCACTGTCAACGAGTTGATCACGAACCTGCGTGAGCGTGCGGAGGAGACTCGTACGGACACCC
GCAGCCGGGTCGAGGAGAGCCGTGCTCGCCTGACCAAGCTGCAGGAAGATCTGCCCGAGCAGCTCACCGA
GCTGCGTGAGAAGTTCACCGCCGAGGAGCTGCGTAAGGCCGCCGAGGGCTACCTCGAGGCCGCGACTAGC
CGGTACAACGAGCTGGTCGAGCGCGGTGAGGCCGCTCTAGAGCGGCTGCGCAGCCAGCAGAGCTTCGAGG
AAGTGTCGGCGCGCGCCGAAGGCTACGTGGACCAGGCGGTGGAGTTGACCCAGGAGGCGTTGGGTACGGT
CGCATCGCAGACCCGCGCGGTCGGTGAGCGTGCCGCCAAGCTGGTCGGCATCGAGCTGCCTAAGAAGGCT
GCTCCGGCCAAGAAGGCCGCTCCGGCCAAGAAGGCCGCTCCGGCCAAGAAGGCGGCGGCCAAGAAGGCGC
CCGCGAAGAAGGCGGCGGCCAAGAAGGTCACCCAGAAGTA

Protein Sequence
>YP_001281765.1 iron-regulated heparin binding hemagglutinin Hbha [Mycobacterium tuberculosis H37Ra]
MAENSNIDDIKAPLLAALGAADLALATVNELITNLRERAEETRTDTRSRVEESRARLTKLQEDLPEQLTE
LREKFTAEELRKAAEGYLEAATSRYNELVERGEAALERLRSQQSFEEVSARAEGYVDQAVELTQEALGTV
ASQTRAVGERAAKLVGIELPKKAAPAKKAAPAKKAAPAKKAAAKKAPAKKAAAKKVTQK

Molecule Role Protective antigen
Molecule Role Annotation Purified preparations of HBHA were emulsified in a dimethyldioctadecylammonium bromide-monophosphoryl lipid A adjuvant and tested for the ability to reduce M. tuberculosis infection in the mouse aerosol challenge model for tuberculosis. The HBHA-containing vaccine gave a approximately 0.7-log reduction in CFU in both mouse lungs and spleens compared to adjuvant controls 28 days following challenge (Parra et al., 2004).
Related Vaccines(s) M. tuberculosis HBHA Protein Vaccine
References