VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

hspB

Gene Name hspB
Sequence Strain (Species/Organism) Helicobacter pylori 85P
VO ID VO_0012378
NCBI Protein GI 712831
Other Database IDs CDD:234573
CDD:237231
CDD:239460
Taxonomy ID 210
Gene Strand (Orientation) ?
Protein Name heat shock protein
Protein pI 5.47
Protein Weight 53926.66
Protein Length 607
Protein Note chaperonin GroEL; Reviewed; PRK00013
Protein Sequence
>AAC41441.1 heat shock protein [Helicobacter pylori]
MAKEIKFSDSARNLLFEGVRQLHDAVKVTMGPRGRNVLIQKSYGAPSITKDGVSVAKEIELSCPVANMGA
QLVKEDASKTADAAGDGTTTATVLAYSIFKEGLRNITAGANPIEVKRGMDKAPEAIINELKKASKKVGGK
EEITQVATISANSDHNIGKLIADAMEKVGKDGVITVEEAKGIEDELDVVEGMQFDRGYLSPYFVTNAEKM
TAQLDNAYILLTDKKISSMKDILPLLEKTMKEGKPLLIIAEDIEGEALTTLVVNKLRGVLNIAAVKAPGF
GDRRKEMLKDIAVLTGGQVISEELGLSLENAEVEFLGKAKIVIDKDNTTIVDGKGHSHDVKDRVAQIKTQ
IASTTSDYDKEKLQERLAKLSGGVAVIKVGAASEVEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIRA
AQKVHLNLHDDEKVGYEIIMRAIKAPLAQIAINAGYDGGVVVNEVEKHEGHFGFNASNGKYVDMFKEGII
DPLKVERIALQNAVSVSSLLLTTEATVHEIKEEKAAPAMPDMGGMGGMGGMGGMM

Molecule Role Protective antigen
Molecule Role Annotation Orogastric immunization of mice with recombinant H. pylori HspB proteins protected 70% of animals from a challenge dose of 104 Helicobacter felis bacteria (Ferrero et al., 1995).
Related Vaccines(s) H. pylori DNA vaccine pcDNA3.1-hspB , H. pylori HspB Protein Vaccine
References