VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

OspC

Gene Name OspC
Sequence Strain (Species/Organism) Borrelia burgdorferi B31
VO ID VO_0012386
NCBI Gene ID 1194415
NCBI Protein GI 11497024
Locus Tag BB_B19
Genbank Accession AE000792
Protein Accession NP_047005
3D structure: PDB ID 1GGQ
Taxonomy ID 224326
Plasmid No cp26
Gene Starting Position 16902
Gene Ending Position 17534
Gene Strand (Orientation) +
Protein Name outer surface protein C
Protein pI 8.68
Protein Weight 21347.6
Protein Length 210
Protein Note similar to GB:AE000792 percent identity: 100.00; identified by sequence similarity; putative
DNA Sequence
>NC_001903.1:16902-17534 Borrelia burgdorferi B31 plasmid cp26, complete sequence
AATGAAAAAGAATACATTAAGTGCAATATTAATGACTTTATTTTTATTTATATCTTGTAATAATTCAGGG
AAAGATGGGAATACATCTGCAAATTCTGCTGATGAGTCTGTTAAAGGGCCTAATCTTACAGAAATAAGTA
AAAAAATTACGGATTCTAATGCGGTTTTACTTGCTGTGAAAGAGGTTGAAGCGTTGCTGTCATCTATAGA
TGAAATTGCTGCTAAAGCTATTGGTAAAAAAATACACCAAAATAATGGTTTGGATACCGAAAATAATCAC
AATGGATCATTGTTAGCGGGAGCTTATGCAATATCAACCCTAATAAAACAAAAATTAGATGGATTGAAAA
ATGAAGGATTAAAGGAAAAAATTGATGCGGCTAAGAAATGTTCTGAAACATTTACTAATAAATTAAAAGA
AAAACACACAGATCTTGGTAAAGAAGGTGTTACTGATGCTGATGCAAAAGAAGCCATTTTAAAAACAAAT
GGTACTAAAACTAAAGGTGCTGAAGAACTTGGAAAATTATTTGAATCAGTAGAGGTCTTGTCAAAAGCAG
CTAAAGAGATGCTTGCTAATTCAGTTAAAGAGCTTACAAGCCCTGTTGTGGCAGAAAGTCCAAAAAAACC
TTA

Protein Sequence
>NP_047005.1 outer surface protein C (plasmid) [Borreliella burgdorferi B31]
MKKNTLSAILMTLFLFISCNNSGKDGNTSANSADESVKGPNLTEISKKITDSNAVLLAVKEVEALLSSID
EIAAKAIGKKIHQNNGLDTENNHNGSLLAGAYAISTLIKQKLDGLKNEGLKEKIDAAKKCSETFTNKLKE
KHTDLGKEGVTDADAKEAILKTNGTKTKGAEELGKLFESVEVLSKAAKEMLANSVKELTSPVVAESPKKP

Molecule Role Protective antigen
Molecule Role Annotation Mice immunized with recombinant OspC protein were protected from challenge with Borrelia burgdorferi (Probert and LeFebvre, 1994).
Related Vaccines(s) B. burgdorferi DNA vaccine pCMV-ZS7/TPA encoding OspC from Borrelia burgdorferi sensu lato , B. burgdorferi OspC Protein Vaccine
References