VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

OprF

Gene Name OprF
Sequence Strain (Species/Organism) Pseudomonas aeruginosa PAO1
VO ID VO_0012360
NCBI Gene ID 878442
NCBI Protein GI 15596974
Locus Tag PA1777
Genbank Accession AE004091
Protein Accession NP_250468
Taxonomy ID 208964
Gene Starting Position 1921173
Gene Ending Position 1922225
Gene Strand (Orientation) +
Protein Name outer membrane porin F
Protein pI 4.75
Protein Weight 34266.56
Protein Length 350
DNA Sequence
>NC_002516.2:1921173-1922225 Pseudomonas aeruginosa PAO1 chromosome, complete genome
GATGAAACTGAAGAACACCTTAGGCGTTGTCATCGGCTCGCTGGTTGCCGCTTCGGCAATGAACGCCTTT
GCCCAGGGCCAGAACTCGGTAGAGATCGAAGCCTTCGGCAAGCGCTACTTCACCGACAGCGTTCGCAACA
TGAAGAACGCGGACCTGTACGGCGGCTCGATCGGTTACTTCCTGACCGACGACGTCGAGCTGGCGCTGTC
CTACGGTGAGTACCATGACGTTCGTGGCACCTACGAAACCGGCAACAAGAAGGTCCACGGCAACCTGACC
TCCCTGGACGCCATCTACCACTTCGGTACCCCGGGCGTAGGTCTGCGTCCGTACGTGTCGGCTGGTCTGG
CTCACCAGAACATCACCAACATCAACAGCGACAGCCAAGGCCGTCAGCAGATGACCATGGCCAACATCGG
CGCTGGTCTGAAGTACTACTTCACCGAGAACTTCTTCGCCAAGGCCAGCCTCGACGGCCAGTACGGTCTG
GAGAAGCGTGACAACGGTCACCAGGGCGAGTGGATGGCTGGCCTGGGCGTCGGCTTCAACTTCGGTGGTT
CGAAAGCCGCTCCGGCTCCGGAACCGGTTGCCGACGTTTGCTCCGACTCCGACAACGACGGCGTTTGCGA
CAACGTCGACAAGTGCCCGGATACCCCGGCCAACGTCACCGTTGACGCCAACGGCTGCCCGGCTGTCGCC
GAAGTCGTACGCGTACAGCTGGACGTGAAGTTCGACTTCGACAAGTCCAAGGTCAAAGAGAACAGCTACG
CTGACATCAAGAACCTGGCTGACTTCATGAAGCAGTACCCGTCCACTTCCACCACCGTTGAAGGTCACAC
CGACTCCGTCGGCACCGACGCTTACAACCAGAAGCTGTCCGAGCGTCGTGCCAACGCCGTTCGTGACGTA
CTGGTCAACGAGTACGGTGTAGAAGGTGGTCGCGTGAACGCTGTTGGTTACGGCGAGTCCCGCCCGGTTG
CCGACAACGCCACCGCTGAAGGCCGCGCTATCAACCGTCGCGTTGAAGCCGAAGTAGAAGCTGAAGCCAA
GTA

Protein Sequence
>NP_250468.1 outer membrane porin F [Pseudomonas aeruginosa PAO1]
MKLKNTLGVVIGSLVAASAMNAFAQGQNSVEIEAFGKRYFTDSVRNMKNADLYGGSIGYFLTDDVELALS
YGEYHDVRGTYETGNKKVHGNLTSLDAIYHFGTPGVGLRPYVSAGLAHQNITNINSDSQGRQQMTMANIG
AGLKYYFTENFFAKASLDGQYGLEKRDNGHQGEWMAGLGVGFNFGGSKAAPAPEPVADVCSDSDNDGVCD
NVDKCPDTPANVTVDANGCPAVAEVVRVQLDVKFDFDKSKVKENSYADIKNLADFMKQYPSTSTTVEGHT
DSVGTDAYNQKLSERRANAVRDVLVNEYGVEGGRVNAVGYGESRPVADNATAEGRAINRRVEAEVEAEAK

Molecule Role Protective antigen
Molecule Role Annotation The oprF gene was cloned into plasmid vector pVR1020, and the plasmid vaccines were delivered to mice by biolistic (gene gun) intradermal inoculation. Following the initial immunization and two consecutive boosts, each at 2-week intervals, protection was demonstrated in a mouse model of chronic pulmonary infection by P. aeruginosa. Eight days postchallenge, both lungs were removed and examined. A significant reduction in the presence of severe macroscopic lesions, as well as in the number of bacteria present in the lungs, was seen (Price et al., 2001).
Our data showed that mice immunized with OprF/OprI or OprF/OprI and flagellin B are significantly protected from infection caused by mucoid and nonmucoid strains of P. aeruginosa.(Hassan et al., 2018).
Related Vaccines(s) P. aeruginosa DNA Vaccine encoding OprF , P. aeruginosa DNA vaccine pGACAG-OprF/OprI , P. aeruginosa DNA vaccine pGACAG-OprF/OprI + pGACAG-PcrV + pGACAG-PilA
References