VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PcrV

Gene Name PcrV
Sequence Strain (Species/Organism) Pseudomonas aeruginosa PAO1
VO ID VO_0012361
NCBI Gene ID 882997
NCBI Protein GI 15596903
Locus Tag PA1706
Genbank Accession AE004091
Protein Accession NP_250397
Taxonomy ID 208964
Gene Starting Position 1852287
Gene Ending Position 1853171
Gene Strand (Orientation) +
Protein Name type III secretion protein PcrV
Protein pI 4.77
Protein Weight 30496.99
Protein Length 294
DNA Sequence
>NC_002516.2:1852287-1853171 Pseudomonas aeruginosa PAO1 chromosome, complete genome
GATGGAAGTCAGAAACCTTAATGCCGCTCGCGAGCTGTTCCTGGACGAGCTCCTGGCCGCGTCGGCGGCG
CCTGCCAGTGCCGAGCAGGAGGAACTGCTGGCCCTGTTGCGCAGCGAGCGGATCGTGCTGGCCCACGCCG
GCCAGCCGCTGAGCGAGGCGCAAGTGCTCAAGGCGCTCGCCTGGTTGCTCGCGGCCAATCCGTCCGCGCC
TCCGGGGCAGGGCCTCGAGGTACTCCGCGAAGTCCTGCAGGCACGTCGGCAGCCCGGTGCGCAGTGGGAT
CTGCGCGAGTTCCTGGTGTCGGCCTATTTCAGCCTGCACGGGCGTCTCGACGAGGATGTCATCGGTGTCT
ACAAGGATGTCCTGCAGACCCAGGACGGCAAGCGCAAGGCGCTGCTCGACGAGCTCAAGGCGCTGACCGC
GGAGTTGAAGGTCTACAGCGTGATCCAGTCGCAGATCAACGCCGCGCTGTCGGCCAAGCAGGGCATCAGG
ATCGACGCTGGCGGTATCGATCTGGTCGACCCCACGCTATATGGCTATGCCGTCGGCGATCCCAGGTGGA
AGGACAGCCCCGAGTATGCGCTGCTGAGCAATCTGGATACCTTCAGCGGCAAGCTGTCGATCAAGGATTT
TCTCAGCGGCTCGCCGAAGCAGAGCGGGGAACTCAAGGGCCTCAGCGATGAGTACCCCTTCGAGAAGGAC
AACAACCCGGTCGGCAATTTCGCCACCACGGTGAGCGACCGCTCGCGTCCGCTGAACGACAAGGTCAACG
AGAAGACCACCCTGCTCAACGACACCAGCTCCCGCTACAACTCGGCGGTCGAGGCGCTCAACCGCTTCAT
CCAGAAATACGACAGCGTCCTGCGCGACATTCTCAGCGCGATCTA

Protein Sequence
>NP_250397.1 type III secretion protein PcrV [Pseudomonas aeruginosa PAO1]
MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAP
PGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTA
ELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDF
LSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFI
QKYDSVLRDILSAI

Molecule Role Protective antigen
Molecule Role Annotation Burned Pseudomonas aeruginosa-infected mice immunized against PcrV, a type III virulence system translocating protein, showed significantly enhanced survival compared to controls (Holder et al., 2001).
The results clearly show that, with PcrV as the vaccine antigen, all three adjuvants tested, FA, alum and CpG ODN, were effective in inducing protective immunity against infection with P. aeruginosa. (Hamaoka et al., 2017)
Related Vaccines(s) P. aeruginosa DNA vaccine pGACAG-OprF/OprI + pGACAG-PcrV + pGACAG-PilA , P. aeruginosa DNA vaccine pGACAG-PcrV , P. aeruginosa PcrV Protein Vaccine
References