Modified YscF antigens were able to partially protect immunized mice at various levels against lethal challenge with Y. pestis KIM 1001 strain (Wang et al., 2008).
Wang et al., 2008: Wang S, Joshi S, Mboudjeka I, Liu F, Ling T, Goguen JD, Lu S. Relative immunogenicity and protection potential of candidate Yersinia Pestis antigens against lethal mucosal plague challenge in Balb/C mice. Vaccine. 2008; 26(13); 1664-1674. [PubMed: 18291562].
>NP_857922.1 type III secretion protein (plasmid) [Yersinia pestis]
MSNFSGFTKGTDIADLDAVAQTLKKPADDANKAVNDSIAALKDKPDNPALLADLQHSINKWSVIYNINST
IVRSMKDLMQGILQKFP