Purified recombinant ApfA elicited an elevated humoral immune response and conferred robust protection against challenges with A. pleuropneumoniae serovar 1 strain 4074 and serovar 7 strain WF83 in mice (Zhou et al., 2013).
Zhou et al., 2013: Zhou Y, Li L, Chen Z, Yuan H, Chen H, Zhou R. Adhesion protein ApfA of Actinobacillus pleuropneumoniae is required for pathogenesis and is a potential target for vaccine development. Clinical and vaccine immunology : CVI. 2013; 20(2); 287-294. [PubMed: 23269417].
>AAO64346.1 major type IV fimbrial subunit precursor [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
MQKLSLIRPLTNAFTLIELMIVIAIIAILATVAIPSYNSYTQKAALSELLAASASYKTDVEICIYNTGDS
KNCSGGQNGVRKMTELRQAKYLNAITVEGGTITVTGKGNLQEYGYTMTPIHNGSTISWETKCKGEDLSLF
PANFCASN
