VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (33)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


Mtb72F

General Information
Protegen ID 584
Sequence Strain (Species/Organism) Mycobacterium tuberculosis
VO ID VO_0011173
Taxonomy ID 32630
Molecule Role Protective antigen
Molecule Role Annotation Our lead construct, Mtb72F, codes for a 72-kDa polyprotein genetically linked in tandem in the linear order Mtb32(C)-Mtb39-Mtb32(N). All forms of Mtb72F immunization tested resulted in the protection of C57BL/6 mice against aerosol challenge with a virulent strain of M. tuberculosis (Skeiky et al., 2004).
Related Vaccines(s) M. tuberculosis Mtb72F Protein Subunit Vaccine
References
Skeiky et al., 2004: Skeiky YA, Alderson MR, Ovendale PJ, Guderian JA, Brandt L, Dillon DC, Campos-Neto A, Lobet Y, Dalemans W, Orme IM, Reed SG. Differential immune responses and protective efficacy induced by components of a tuberculosis polyprotein vaccine, Mtb72F, delivered as naked DNA or recombinant protein. Journal of immunology (Baltimore, Md. : 1950). 2004 Jun 15; 172(12); 7618-28. [PubMed: 15187142].
Gene Information
Gene Name Mtb72F
Protein Information
NCBI Protein GI 283801990
Protein pI 4.95
Protein Weight 66088.21
Protein Length 799
Protein Note Description of Artificial Sequence:tri-fusion protein MTB72F (Ra12-TbH9-Ra35 or MTB32-MTB39 fusion)
Protein Sequence
>CBI85484.1 unnamed protein product [synthetic construct]
MHHHHHHTAASDNFQLSQGGQGFAIPIGQAMAIAGQIRSGGGSPTVHIGPTAFLGLGVVDNNGNGARVQR
VVGSAPAASLGISTGDVITAVDGAPINSATAMADALNGHHPGDVISVTWQTKSGGTRTGNVTLAEGPPAE
FMVDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSVVWGLTVGSWIGSSAGLMVAA
ASPYVAWMSVTAGQAELTAAQVRVAAAAYETAYGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEA
EYGEMWAQDAAAMFGYAAATATATATLLPFEEAPEMTSAGGLLEQAAAVEEASDTAAANQLMNNVPQALQ
QLAQPTQGTTPSSKLGGLWKTVSPHRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAARQAVQ
TAAQNGVRAMSSLGSSLGSSGLGGGVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLTSAAER
GPGQMLGGLPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAGDIAPPALSQDRFADFPALPLDPSAMVAQ
VGPQVVNINTKLGYNNAVGAGTGIVIDPNGVVLTNNHVIAGATDINAFSVGSGQTYGVDVVGYDRTQDVA
VLQLRGAGGLPSAAIGGGVAVGEPVVAMGNSGGQGGTPRAVPGRVVALGQTVQASDSLTGAEETLNGLIQ
FDAAIQPGDSGGPVVNGLGQVVGMNTAAS

Vaxign Prediction
Localization(Probability) Unknown
(Prob.=0.25)
Adhesin Probability 0.718
Trans-membrane Helices 0
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope