VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (28)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


PRO2

General Information
Protegen ID 690
Sequence Strain (Species/Organism) Phleum pratense
Taxonomy ID 15957
Other Database IDs CDD:238085
Molecule Role Protective antigen
Molecule Role Annotation The cDNA coding for timothy grass pollen profilin, Phl p 12, was used as a template to develop a new strategy for engineering an allergy vaccine with low IgE reactivity. Non-IgE-reactive fragments of Phl p 12 were identified by synthetic peptide chemistry and restructured (rs) as a new molecule, Phl p 12-rs. It comprised the C terminus of Phl p 12 at its N terminus and the Phl p 12 N terminus at its C terminus. Phl p 12-rs was expressed in Escherichia coli and purified to homogeneity. IgG Abs induced by immunization of mice and rabbits with Phl p 12-rs cross-reacted with pollen and food-derived profilins. Recombinant Phl p 12-rs, rPhl p 12-rs, induced less reaginic IgE to the wild-type allergen than rPhl p 12. However, the rPhl p 12-rs-induced IgGs inhibited allergic patients' IgE Ab binding to profilins to a similar degree as those induced by immunization with the wild type. Phl p 12-rs specific IgG inhibited profilin-induced basophil degranulation. In conclusion, a restructured recombinant vaccine was developed for the treatment of profilin-allergic patients (Westritschnig et al., 2007).
Related Vaccines(s) Phleum pratense Allergy Phl p 12 Subunit Vaccine
References
Westritschnig et al., 2007: Westritschnig K, Linhart B, Focke-Tejkl M, Pavkov T, Keller W, Ball T, Mari A, Hartl A, Stöcklinger A, Scheiblhofer S, Thalhamer J, Ferreira F, Vieths S, Vogel L, Böhm A, Valent P, Valenta R. A hypoallergenic vaccine obtained by tail-to-head restructuring of timothy grass pollen profilin, Phl p 12, for the treatment of cross-sensitization to profilin. Journal of immunology (Baltimore, Md. : 1950). 2007; 179(11); 7624-7634. [PubMed: 18025208].
Gene Information
Gene Name PRO2
Protein Information
Protein Name Profilin-2
NCBI Protein GI 3914432
Protein pI 5.91
Protein Weight 16483.64
Protein Length 311
Protein Note Allergen Phl p 11; Pollen allergen Phl p 12; Profilin 4
Protein Sequence
>sp|O24650.1|PROF2_PHLPR RecName: Full=Profilin-2; AltName: Full=Allergen Phl p 11; AltName: Full=Pollen allergen Phl p 12; AltName: Full=Profilin 4; AltName: Allergen=Phl p 12
MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVAGA
KYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGM

Epitope Information
IEDB Linear Epitope