The potential protection of Lmjsp (Leishmania major signal peptidase) was evaluated in three different vaccination strategies (DNA/DNA, Protein/Protein and DNA/Protein), against L. major infection. We demonstrated that vaccination with SPase through all three mentioned strategies induced a parasite specific Th1 response and conferred partial protection against parasite challenge. However, our results indicated that DNA/DNA strategy developed more effective protective responses than the other two approaches and induced 81% reduction in L. major parasite load (Rafati et al., 2006).
Rafati et al., 2006: Rafati S, Ghaemimanesh F, Zahedifard F. Comparison of potential protection induced by three vaccination strategies (DNA/DNA, Protein/Protein and DNA/Protein) against Leishmania major infection using Signal Peptidase type I in BALB/c mice. Vaccine. 2006; 24(16); 3290-3297. [PubMed: 16481076].
The S24, S26 LexA/signal peptidase superfamily contains LexA-related and type I signal peptidase families. The S24 LexA protein domains include: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the...; cl10465
Protein Sequence
>AAN08877.1 signal peptidase type I [Leishmania major]
MREHINTLLSLRVRDVIQQVVTVGLFLSIVLVGWRAVAVGTNCEASIVVVLSGSMEPGYYRGDVLLLHHR
PEYPVTVGDIIVYTLPGQEIPIVHRVHRIHQRSEDGKKFYLTKGDNNVNDDRFLFRNGREWVEEGMIIGK
TYAYVPRIGYLTIMFNESKIIKYLALGLIGFFLLTTTDEM
