Immunisation of mice with cDNA encoding the nucleocapsid protein induced strong humoral and lymphocyte proliferative immune responses. Even though complete protection was not achieved by genetic immunisation, four out of eight mice vaccinated with cDNA encoding the nucleocapsid protein displayed no clinical signs of infection after challenge. In contrast, all fourteen control animals displayed clinical manifestations of Rift Valley Fever after challenge (Lagerqvist et al., 2009).
Lagerqvist et al., 2009: Lagerqvist N, Näslund J, Lundkvist A, Bouloy M, Ahlm C, Bucht G. Characterisation of immune responses and protective efficacy in mice after immunisation with Rift Valley Fever virus cDNA constructs. Virology journal. 2009; 6; 6. [PubMed: 19149901].
>NP_049344.1 N protein [Rift Valley fever virus]
MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRR
MMMKMSKEGKATVEALINKYKLKEGNPSRDELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAY
PRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNAAVNSNFIS
HEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA
