VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (33)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


HBHA

General Information
Protegen ID 821
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Ra
VO ID VO_0012373
Taxonomy ID 25177
Molecule Role Protective antigen
Molecule Role Annotation Purified preparations of HBHA were emulsified in a dimethyldioctadecylammonium bromide-monophosphoryl lipid A adjuvant and tested for the ability to reduce M. tuberculosis infection in the mouse aerosol challenge model for tuberculosis. The HBHA-containing vaccine gave a approximately 0.7-log reduction in CFU in both mouse lungs and spleens compared to adjuvant controls 28 days following challenge (Parra et al., 2004).
Related Vaccines(s) M. tuberculosis HBHA Protein Vaccine
References
Parra et al., 2004: Parra M, Pickett T, Delogu G, Dheenadhayalan V, Debrie AS, Locht C, Brennan MJ. The mycobacterial heparin-binding hemagglutinin is a protective antigen in the mouse aerosol challenge model of tuberculosis. Infection and immunity. 2004; 72(12); 6799-6805. [PubMed: 15557600].
Gene Information
Gene Name HBHA
NCBI Gene ID 5211814
Genbank Accession CP000611
Locus Tag MRA_0482
Gene Starting Position 567106
Gene Ending Position 567705
DNA Sequence
>NC_009525.1:567106-567705 Mycobacterium tuberculosis H37Ra, complete genome
CATGGCTGAAAACTCGAACATTGATGACATCAAGGCTCCGTTGCTTGCCGCGCTTGGAGCGGCCGACCTG
GCCTTGGCCACTGTCAACGAGTTGATCACGAACCTGCGTGAGCGTGCGGAGGAGACTCGTACGGACACCC
GCAGCCGGGTCGAGGAGAGCCGTGCTCGCCTGACCAAGCTGCAGGAAGATCTGCCCGAGCAGCTCACCGA
GCTGCGTGAGAAGTTCACCGCCGAGGAGCTGCGTAAGGCCGCCGAGGGCTACCTCGAGGCCGCGACTAGC
CGGTACAACGAGCTGGTCGAGCGCGGTGAGGCCGCTCTAGAGCGGCTGCGCAGCCAGCAGAGCTTCGAGG
AAGTGTCGGCGCGCGCCGAAGGCTACGTGGACCAGGCGGTGGAGTTGACCCAGGAGGCGTTGGGTACGGT
CGCATCGCAGACCCGCGCGGTCGGTGAGCGTGCCGCCAAGCTGGTCGGCATCGAGCTGCCTAAGAAGGCT
GCTCCGGCCAAGAAGGCCGCTCCGGCCAAGAAGGCCGCTCCGGCCAAGAAGGCGGCGGCCAAGAAGGCGC
CCGCGAAGAAGGCGGCGGCCAAGAAGGTCACCCAGAAGTA

Protein Information
Protein Name iron-regulated heparin binding hemagglutinin Hbha
NCBI Protein GI 148660242
Protein Accession YP_001281765
Protein pI 9.84
Protein Weight 20541.79
Protein Length 199
Protein Sequence
>YP_001281765.1 iron-regulated heparin binding hemagglutinin Hbha [Mycobacterium tuberculosis H37Ra]
MAENSNIDDIKAPLLAALGAADLALATVNELITNLRERAEETRTDTRSRVEESRARLTKLQEDLPEQLTE
LREKFTAEELRKAAEGYLEAATSRYNELVERGEAALERLRSQQSFEEVSARAEGYVDQAVELTQEALGTV
ASQTRAVGERAAKLVGIELPKKAAPAKKAAPAKKAAPAKKAAAKKAPAKKAAAKKVTQK

Vaxign Prediction
Localization(Probability) Cellwall
(Prob.=1)
Adhesin Probability 0.676
Trans-membrane Helices 0
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope