VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (28)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


hspA

General Information
Protegen ID 825
Sequence Strain (Species/Organism) Helicobacter pylori 85P
VO ID VO_0012377
Taxonomy ID 210
Other Database IDs CDD:178988
CDD:238197
Molecule Role Protective antigen
Molecule Role Annotation Orogastric immunization of mice with recombinant H. pylori HspA proteins protected 80% of animals from a challenge dose of 10^4 Helicobacter felis bacteria (Ferrero et al., 1995).
The highest reduction in bacterial colonization was seen in mice immunized with the fusion protein rHspA-GGT when paired with the mucosal adjuvant LTB. Protection against H. pylori colonization was mediated by a strong systemic and localized humoral immune response (Zhang et al., 2015).
Related Vaccines(s) H. pylori DNA vaccine pcDNA3.1-hspA , H. pylori HspA Protein Vaccine
References
Ferrero et al., 1995: Ferrero RL, Thiberge JM, Kansau I, Wuscher N, Huerre M, Labigne A. The GroES homolog of Helicobacter pylori confers protective immunity against mucosal infection in mice. Proceedings of the National Academy of Sciences of the United States of America. 1995; 92(14); 6499-6503. [PubMed: 7604021].
Zhang et al., 2015: Zhang X, Zhang J, Yang F, Wu W, Sun H, Xie Q, Si W, Zou Q, Yang Z. Immunization with Heat Shock Protein A and γ-Glutamyl Transpeptidase Induces Reduction on the Helicobacter pylori Colonization in Mice. PloS one. 2015; 10(6); e0130391. [PubMed: 26102080].
Gene Information
Gene Name hspA
Protein Information
Protein Name heat shock protein
NCBI Protein GI 712830
Protein pI 6.66
Protein Weight 12280.01
Protein Length 174
Protein Note co-chaperonin GroES; Reviewed; PRK00364
Protein Sequence
>AAC41440.1 heat shock protein [Helicobacter pylori]
MKFQPLGERVLVERLEEENKTSSGIIIPDNAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEI
VLDGVEYMVLELEDILGIVGSGSCCHTGNHDHKHAKEHEACCHDHKKH

Epitope Information
IEDB Linear Epitope