VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Ag85B from M. tuberculosis H37Rv

Gene Name Ag85B from M. tuberculosis H37Rv
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
VO ID VO_0012364
NCBI Gene ID 885785
NCBI Protein GI 15609023
Locus Tag Rv1886c
Genbank Accession AL123456
Protein Accession NP_216402
Other Database IDs EMBL: AE000516
EMBL: AF198032
EMBL: BX842578
EMBL: U38939
EMBL: X62398
GenomeReviews: AE000516_GR
GenomeReviews: AL123456_GR
InterPro: IPR000801
KEGG: mtc:MT1934
KEGG: mtu:Rv1886c
PDB: 1F0N
PDB: 1F0P
Pfam: PF00756
PIR: C70516
TIGR: MT1934
TubercuList: Rv1886c
UniProt: P31952
Taxonomy ID 83332
Gene Starting Position 2134889
Gene Ending Position 2135866
Gene Strand (Orientation) -
Protein Name diacylglycerol acyltransferase/mycolyltransferase Ag85B
Protein pI 5.72
Protein Weight 33091.46
Protein Length 325
Protein Note Rv1886c, (MT1934, MTCY180.32), len: 325 aa. fbpB (alternate gene names: mpt59, 85B), precursor of the 85-B antigen (fibronectin-binding protein B) (mycolyl transferase 85B) (EC 2.3.1.-) (see citations below), highly similar to other Mycobacterial antigen precursors e.g. P12942|A85B_MYCBO ANTIGEN 85-B PRECURSOR from Mycobacterium bovis (323 aa); P21160|A85B_MYCKA ANTIGEN 85-B PRECURSOR from Mycobacterium kansasii (325 aa); etc. Also highly similar to Mycobacterium tuberculosis antigen precursors: Rv3804c|fbpA (338 aa), Rv0129c|fbpC2 (340 aa), and Rv3803c|fbpC1 (299 aa). TBparse score is 0.912.; mpt59; 85B
Protein Annotation FUNCTION: Proteins of the antigen 85 complex are responsible for the high affinity of mycobacteria to fibronectin. Possesses a mycolyltransferase activity required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary for maintaining cell wall integrity (UniProt: P31952)

SUBCELLULAR LOCATION: Secreted protein (UniProt: P31952)

SIMILARITY: Belongs to the mycobacterial A85 antigen family (UniProt: P31952)
DNA Sequence
>NC_000962.3:2134889-2135866 Mycobacterium tuberculosis H37Rv, complete genome
GTCAGCCGGCGCCTAACGAACTCTGCAGGTCACCCTTCATGGCGTTGAGCTGAGCGCCCCAGTACTCCCA
GCTGTGCGTGCCGTTGGGCGGGAAGTTGAACACGGCGTTGTGCCCGCCCGCGGCGTTGTACGCATCCTGG
AACTTCAGGTTGCTGCTACGAACGAAGTTCTCCAAGAACTCGGCGGGTATGTTGGCACCGCCCAACTCGT
TCGGGGTGCCGTTCCCGCAATAAACCCATAGCCGGGTGTTGTTTGCGACCAGCTTGGGGATCTGCTGCGT
AGGGTCGTTGCGCTCCCATGCCGGGTCACTCGAGGGACCCCACATGTCTGCGGCCTTGTAACCGCCGGCG
TCACCCATCGCGAGGCCGATCAGGCTAGGCCCCATCCCCTGAGAGGGGTCCAGCAGGGCCGACAGCGAGC
CGGCGTAGATGAACTGCTGGGGGTGGTAGGCGGCCAAGATCATTGCCGACGAGCCGGCCATCGACAAGCC
GATTGCAGCGCTGCCGGTGGGCTTCACGGCCCTGTTGGCGGACAACCATTGCGGCAGCTCGCTGGTCAGG
AAGGTTTCCCACTTGTAAGTCTGGCAGCCAGCCTTACCGCAGGCCGGGCTGTACCAGTCGCTGTAGAAGC
TGGACTGCCCGCCGACCGGCATGACTATCGACAGTCCCGACTGGTAGTACCACTCGAACGCCGGGGTGTT
GATATCCCAGCCGTTGTAGTCGTCTTGGGCGCGCAGGCCGTCGAGCAGATAAACCGCAGGTGAGTTGTTC
CCACCGCTCTGGAACTGAACCTTGATGTCGCGGCCCATCGACGGCGACGGCACCTGCAGGTACTCGACCG
GCAGCCCCGGCCGGGAGAACGCGCCCGCGGTTGCCGCTCCGCCGGCAAGCCCCACCAGGCCCGGAAGGAC
TACAGCCGCTGCCGTGCCGATCATCAATCGGCGTCCCCAAGCTCGAATCTTTCGGCTCACGTCTGTCA

Protein Sequence
>NP_216402.1 diacylglycerol acyltransferase/mycolyltransferase Ag85B [Mycobacterium tuberculosis H37Rv]
MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGG
NNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETF
LTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGD
AGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKF
QDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG

Molecule Role Protective antigen
Molecule Role Annotation In mice, a primary vaccination with Ag85B-encoding plasmid DNA (DNA-85B) was protective against Mycobacterium tuberculosis (MTB) infection and associated with Ag85B-specific CD4+ T cells producing IFN-gamma and controlling intramacrophagic MTB growth (Palma et al., 2007).
Related Vaccines(s) Ag85B and ESAT-6 fusion protein , Arabinomannan-tetanus toxoid conjugate , LT-BCG- Ag85B /Rv3425 , M. tuberculosis DNA Vaccine encoding Ag85B Protein , M. tuberculosis DNA vaccine encoding Ag85B, MPT64 and MPT83 , MVA/IL-15/5Mtb vaccine , rBCG-Ag85A/ Ag85B
References