VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

FbpA (Ag85A)

Gene Name FbpA (Ag85A)
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
VO ID VO_0010952
NCBI Gene ID 886132
NCBI Protein GI 15610940
Locus Tag Rv3804c
Genbank Accession AL123456
Protein Accession NP_218321
3D structure: PDB ID 1SFR
Other Database IDs EMBL: AE000516
EMBL: BX842584
EMBL: M27016
EMBL: U47335
GenomeReviews: AE000516_GR
GenomeReviews: AL123456_GR
InterPro: IPR000801
KEGG: mtc:MT3911
KEGG: mtu:Rv3804c
PDB: 1SFR
Pfam: PF00756
PIR: H70887
TIGR: MT3911
TubercuList: Rv3804c
UniProt: P0A4V2
Taxonomy ID 83332
Gene Starting Position 4265641
Gene Ending Position 4266657
Gene Strand (Orientation) -
Protein Name diacylglycerol acyltransferase/mycolyltransferase Ag85A
Protein pI 6.51
Protein Weight 33304.71
Protein Length 338
Protein Note Rv3804c, (MT3911, MTV026.09c), len: 338 aa. fbpA (alternate gene names: mpt44, 85A), precursor of the 85-A antigen (fibronectin-binding protein A) (mycolyl transferase 85A) (EC 2.3.1.-) (see citations below), identical to P17944|P17996|FBPA|MPT44 ANTIGEN 85-A PRECURSOR from Mycobacterium bovis (338 aa), FASTA scores: opt: 2341, E(): 1.2e-132, (100.0% identity in 338 aa overlap); and highly similar to other Mycobacterial antigen precursors e.g. O52956|A85A_MYCAV|FBPA ANTIGEN 85-A PRECURSOR (85A) from Mycobacterium avium (347 aa), FASTA scores: opt: 1987, E(): 1.7e-111, (82.55% identity in 338 aa overlap); Q05861|A85A_MYCLE|FBPA|ML0097 ANTIGEN 85-A PRECURSOR (85A) from Mycobacterium leprae (330 aa), FASTA scores: opt: 1936, E(): 1.9e-108, (83.0% identity in 329 aa overlap); O06052|A85A_MYCGO|FBPA ANTIGEN 85-A PRECURSOR (85A) from Mycobacterium gordonae (339 aa), FASTA scores: opt: 1932, E(): 3.3e-108, (80.45% identity in 338 aa overlap); etc. Also highly similar to P31952|A85B_MYCTU|FBPB|Rv1886c|MT1934|MTCY180.32 SECRETED ANTIGEN 85-B from Mycobacterium tuberculosis (325 aa), FASTA scores: opt: 1830, E(): 3.9e-102, (78.85% identity in 317 aa overlap); P31953|A85C_MYCTU|FBPC|MPT45|Rv0129c|MTCI5.03c|FBPC2 SECRETED ANTIGEN 85-C from Mycobacterium tuberculosis (340 aa), FASTA scores: opt: 1597, E(): 3.4e-88, (67.25% identity in 336 aa overlap).; mpt44; 85A
Protein Annotation FUNCTION: Proteins of the antigen 85 complex are responsible for the high affinity of mycobacteria to fibronectin. Possesses a mycolyltransferase activity required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary for maintaining cell wall integrity (UniProt: P0A4V2)

SUBCELLULAR LOCATION: Secreted protein (UniProt: P0A4V2)

PTM: Contains one disulfide bridge (UniProt: P0A4V2)

SIMILARITY: Belongs to the mycobacterial A85 antigen family (UniProt: P0A4V2)
DNA Sequence
>NC_000962.3:4265641-4266657 Mycobacterium tuberculosis H37Rv, complete genome
GCTAGGCGCCCTGGGGCGCGGGCCCGGTGTTGGGCGTGGCACCCAGTGCCCGTTGCAGGTCGGGCTTCAT
AGCGTTGAGCTGCGCGCCCCAGTACTCCCAGCTGTGCGTACCGCTGTCCGGGAAGTCGAACACGCCGTTG
TGGCCGCCACCGGCGTTGTAGGCGTCTTGGAACTTGATGTTGCTGGTCCGCACGAAGCCCTCGAGGAACT
TGGCCGGCAGGTTGTTGCCACCCAGATCCGACGGCTTGCCGTTGCCGCAGTACACCCAGACGCGGGTGTT
GTTGGCGATCAGCTTCCCGACGTTCAACAGCGGGTCGTTGCGCTGCCACGCCGGGTCCTCCTTCGGGCCC
CACATGTCGGAGGCCTTGTAGCCGCCAGCGTCACCCATCGCCAGGCCGATCAGGGTGGGACCCATCGCCT
GGGAGGGGTCCAACAGGCCCGACATCGCTCCCGCGTAGACGAACTGCTGGGGGTGATAGATCGCCAGCGT
CAGCGCCGAAGAAGCAGCCATCGAAAGACCGACGACGGCGCTTCCGGTGGGCTTGACGTGCCTGTTGGCC
TGCAGCCACCCCGGCAGCTCGCTGGTCAGGAAGGTCTCCCACTTGTAAGTCTGGCAACCGGCCTTGCCGC
AGGCGGGCTGGTACCAGTCGGAGTAGAAGCTTGACTGGCCACCCACCGGCATGACCACCGACAGGCCCGA
CTGGTCGTACCACTCGAACGCCGGGGTGTTGATGTCCCAGCCGCTGAAGTCGTCCTGCGCGCGCAGGCCG
TCGAGCAGGTACAGGGCGGGCGAGTTGGCACCACCACTTTGGAATTGGACCTTGATGTCACGGCCCATCG
ACGGCGACGGCACCTGCAGGTACTCCACCGGCAAGCCCGGCCGGGAAAATGCCCCCGCGGTCGCCGTGCC
ACCGACGGCGCCGACCAGACCCGACACTAGGGCCGCGCCGACGGCCCCGACCACGAGTCGACGCGACATA
CCCGTGACGGCGCCACGAACCCTGTCAACAAGCTGCA

Protein Sequence
>NP_218321.1 diacylglycerol acyltransferase/mycolyltransferase Ag85A [Mycobacterium tuberculosis H37Rv]
MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQ
SGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKW
ETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLA
MGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSN
IKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA

Molecule Role Protective antigen
Molecule Role Annotation Researchers have developed DNA vaccines expressing M. tuberculosis antigen 85A (Ag85A, fbpA) and cytokine granulocyte macrophage colony stimulating factor (GM-CSF). The immune strategy of BCG-prime and DNA vaccine boost induced mice to generate efficient immune protection against M. tuberculosis challenge (Dou et al., 2010).
Related Vaccines(s) DNA vaccine co-expressing A85A and caspase-3 , M. tuberculosis DNA vaccine DNAAg85A encoding a single immunogenic M.tb Ag , M. tuberculosis DNA vaccine pcDNA3.1+/Ag85A DNA encoding Ag85A , MVA/IL-15/5Mtb vaccine , MVA85A prime and BCG boost , rBCG-Ag85A/ Ag85B , rBCG-Ag85A[Tokyo]
References