VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

MPT64

Gene Name MPT64
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
VO ID VO_0012367
NCBI Gene ID 885925
NCBI Protein GI 15609117
Locus Tag Rv1980c
Genbank Accession A42312
Protein Accession NP_216496
3D structure: PDB ID 2HHI
Taxonomy ID 83332
Gene Starting Position 2223342
Gene Ending Position 2224028
Gene Strand (Orientation) -
Protein Name immunogenic protein Mpt64
Protein pI 4.6
Protein Weight 23267.4
Protein Length 228
Protein Note Rv1980c, (MT2032, MTCY39.39), len: 228 aa. mpt64 (alternate gene name: mpb64), immunogenic protein (alternate gene name: mpb64) (see citations below), identical to MPT64|MPB64 from Mycobacterium bovis (228 aa). Similar to Rv3036c|MTV012.51c from Mycobacterium tuberculosis. Exported protein containing a N-terminal signal sequence: see notes below about proteomics.; mpb64
DNA Sequence
>NC_000962.3:2223342-2224028 Mycobacterium tuberculosis H37Rv, complete genome
TCTAGGCCAGCATCGAGTCGATCGCGGAACGTGGGACCAATACCTGGGTTGGGCCGGCTGCTTCGGGCAG
CAACTCCCCCGGGTTGAAGAAGAAAATCACCCCGTCGTTCGTGACTGCGAAGTTCTGATAATTCACCGGG
TCCAAGCCGGCATTCGGCGCTATCGATACCTGTTGTCCGGTCTGCTTGCTCAGTTCACCTTGCACAATGG
GGAAGACGACTGGCAGCGGATCGGTGTCAGCCTGCCACAGCGTGTCATAGGTGATTGGCTTGCGATAGGC
CTGGTCCCAATCGAAGGCCTTGTACGTGGTCGTTGGGTGCGTGCCGCCGGCGTTCTGGTAGACCTTGAGC
ACCACGGCCTGCGTACCACGCGGCGGTATCGCGGACTGGTATGTGGCCGAGGTGATATTCAATTCGTAGG
GGGCTTCGCGTGGAGTGGACGATGTGGCCGCGCTGAGGAACTTGTCGCGCGTCTGGGCGATGTAATTTTC
CAGCGACTTCTGGTCGGGGTAGTAACTGGGCAGGCTGATGTTGATGTTGTAGGCCGGGTCGGACATTTGA
ATCTGGCACGCCTGGCCGGTATCGGTGCCTTTCAACTCCTCGCAGTAGGTCTTGGGCGCGGCCGTGGCCA
CACCCGAACAACAGAGCAAAACGACAGCCGTGACCAGCATGAAGATCTTGATGCGCA

Protein Sequence
>NP_216496.1 immunogenic protein Mpt64 [Mycobacterium tuberculosis H37Rv]
MRIKIFMLVTAVVLLCCSGVATAAPKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYI
AQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRK
PITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEA
AGPTQVLVPRSAIDSMLA

Molecule Role Protective antigen
Molecule Role Annotation DNA vaccines encoding secreted proteins Ag85B and MPT64 protect mice from the tuberculosis H37Rv strain (Luo et al., 2004).
*Note* MPT64 in combination with Ag85B was protective, DNA vaccine of just MPT64 was mildly protective in mice.
Related Vaccines(s) M. tuberculosis DNA vaccine (containing the ESAT-6, MPT-64, MPT-83, and KatG constructs) , M. tuberculosis DNA vaccine encoding Ag85B, MPT64 and MPT83
References