VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

KatG

Gene Name KatG
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
VO ID VO_0012369
NCBI Gene ID 885638
NCBI Protein GI 15609045
Locus Tag Rv1908c
Genbank Accession AL123456
Protein Accession NP_216424
3D structure: PDB ID 1SJ2
Taxonomy ID 83332
Gene Starting Position 2153888
Gene Ending Position 2156110
Gene Strand (Orientation) -
Protein Name catalase-peroxidase
Protein pI 4.87
Protein Weight 75544.06
Protein Length 740
Protein Note Rv1908c, (MTCY180.10), len: 740 aa. katG, catalase-peroxidase-peroxynitritase T (EC 1.11.1.6) (see citations below), HPI. FASTA results: Q57215 CATALASE-PEROXIDASE from Mycobacterium tuberculosis (740 aa) opt: 5081, E(): 0, (100% identity in 740 aa overlap). Contains peroxidases active site signature (PS00436) and ATP/GTP-binding site motif A (P-loop; PS00017). Cosmid sequence was corrected to agree with a sequencing read from the H37Rv genome. DELETIONS OR DEFECTS IN KATG GENE CAUSE ISONIAZID (INH) RESISTANCE. BELONGS TO THE PEROXIDASE FAMILY. BACTERIAL PEROXIDASE/CATALASE SUBFAMILY. KATG TRANSCRIPTION SEEMS TO BE REGULATED BY FURA|Rv1909c PRODUCT. The catalase-peroxidase activity is associated with the amino-terminal domain but no definite function has been assigned to the carboxy-terminal domain. TBparse score is 0.923.
DNA Sequence
>NC_000962.3:2153888-2156110 Mycobacterium tuberculosis H37Rv, complete genome
ATCAGCGCACGTCGAACCTGTCGAGGTTCATCACCTTGTCCCAGGCAGCGACGAAGTCCTGCACGAACTT
CGGCTGCGCGTCATCGGCGCCATAGACCTCGACAAGCGCCCGCAACTCCGAGTTGGACCCGAAGACCAGG
TCCACGCGGCTGCCGGTCCACTTCACCTTGCCACTGCCATCCTTGCCCTGGTAGGTCCCGTCATCTGCTG
GCGAGGGCTCCCAGGTGATACCCATGTCGAGCAGGTTCACGAAGAAGTCGTTGGTCAGTGACTCGGAGGC
CTCGGTGAACACGCCCAGCGGTAAGCGCTTGTAGTTTGCGCCGAGGACGCGCAGGCCACCTACCAGCACC
GTCATCTCAGGGGCACTGAGCGTAAGCAGGTTCGCCTTGTCGAGCAGCATGTACTCGGCCGGCAACGGGT
TGCCCTTTCCGAGGTAGTTTCGGAAGCCATCTGCCTTGGGCTCCAGCACGGCAAAGGATTCCACGTCGGT
TTGTTCCTGCGACGCATCCGTGCGGCCCGGGGTGAAGGGCACCGTGATGTTGTGGCCAGCCGCCTTTGCT
GCTTTCTCTATGGCGGCACAGCCACCGAGCACGACGAGGTCGGCGAAGGACACTTTGATGTTCCCCGGCG
CCGCGGAGTTGAATGACTCCTGGATCTCTTCCAGGGTGCGAATGACCTTGCGCAGATCCCCGTCGGGGTC
GTTGACCTCCCACCCGACTTGTGGCTGCAGGCGGATGCGACCACCGTTGGCGCCGCCGCGCTTGTCGCTA
CCACGGAACGACGACGCCGCCGCCCATGCGGTCGAAACTAGCTGTGAGACAGTCAATCCCGATGCCCGGA
TCTGGCTCTTAAGGCTGGCAATCTCGGCTTCGCCGACGAGGTCGTGGCTGACCGCAGGGACCGGATCCTG
CCACAGCAGGGTCTGCTTGGGGACCAGCGGCCCAAGGTATCTCGCAACGGGACCCATGTCTCGGTGGATC
AGCTTGTACCAGGCCTTGGCGAACTCGTCGGCCAATTCCTCGGGGTGTTCCAGCCAGCGACGCGTGATCC
GCTCATAGATCGGATCCACCCGCAGCGAGAGGTCAGTGGCCAGCATCGTCGGGGAGCGCCCTGGCCCGCC
GAACGGGTCCGGGATGGTGCCGGCACCGGCGCCGTCCTTGGCGGTGTATTGCCAAGCGCCAGCAGGGCTC
TTCGTCAGCTCCCACTCGTAGCCGTACAGGATCTCGAGGAAACTGTTGTCCCATTTCGTCGGGGTGTTCG
TCCATACGACCTCGATGCCGCTGGTGATCGCGTCCTTACCGGTTCCGGTGCCATACGAGCTCTTCCAGCC
CAAGCCCATCTGCTCCAGCGGAGCAGCCTCGGGTTCGGGGCCGACCAGATCGGCCGGGCCGGCGCCATGG
GTCTTACCGAAAGTGTGACCGCCGACGATCAGCGCCGCTGTTTCGACGTCGTTCATGGCCATGCGCCGAA
ACGTCTCGCGAATGTCGACCGCCGCGGCCATGGGGTCCGGGTTGCCGTTCGGCCCCTCCGGGTTCACGTA
GATCAGCCCCATCTGCACCGCGGCCAGCGGGTTCTCCAGATCCCGCTTACCGCTGTAACGCTCATCGCCG
AGCCAGGTGGCTTCCTTGCCCCAATAGACCTCATCGGGCTCCCACTGGTCGACCCGGCCGAAGCCGAACC
CGAACGTCTTGAAGCCCATCGATTCCAGCGCGCAGTTGCCGGCGAAAACAATCAGGTCCGCCCATGAGAG
CTTCTTGCCGTACTTCTTCTTGACCGGCCACAGCAGCCGGCGCGCCTTGTCCAAGCTGGCGTTGTCGGGC
CAGCTGTTAAGCGGCGCGAACCGCTGCATGCCGCCCCCGGCGCCGCCGCGGCCGTCGTGGATGCGGTAGG
TGCCGGCAGCGTGCCACGCCATCCGGATAAACAGCGGCCCGTAGTGGCCGTAGTCGGCGGGCCACCACGG
CTGCGAGGTGGTCATCACTTCCTCGATGTCCCGCGTCAGGGCGTCAACGTCGATGGTCGCGACCTCCGCG
GCATAGTCGAACGCCGCACCCATCGGGTCAGCGACGGCCGGGTTTTGGTGCAGTACCTTCAGATTGAGCC
GGTTGGGCCACCAGTCCTGGTTTCCGCCGCCCTCGACGGGGTATTTCATATGACCCACGACGGGACAGCC
GTTGCTAGCGGCTCCGGTGGTGGTTTCTGTAATGGGTGGGTGTTGCTCGGGCA

Protein Sequence
>NP_216424.1 catalase-peroxidase [Mycobacterium tuberculosis H37Rv]
MPEQHPPITETTTGAASNGCPVVGHMKYPVEGGGNQDWWPNRLNLKVLHQNPAVADPMGAAFDYAAEVAT
IDVDALTRDIEEVMTTSQPWWPADYGHYGPLFIRMAWHAAGTYRIHDGRGGAGGGMQRFAPLNSWPDNAS
LDKARRLLWPVKKKYGKKLSWADLIVFAGNCALESMGFKTFGFGFGRVDQWEPDEVYWGKEATWLGDERY
SGKRDLENPLAAVQMGLIYVNPEGPNGNPDPMAAAVDIRETFRRMAMNDVETAALIVGGHTFGKTHGAGP
ADLVGPEPEAAPLEQMGLGWKSSYGTGTGKDAITSGIEVVWTNTPTKWDNSFLEILYGYEWELTKSPAGA
WQYTAKDGAGAGTIPDPFGGPGRSPTMLATDLSLRVDPIYERITRRWLEHPEELADEFAKAWYKLIHRDM
GPVARYLGPLVPKQTLLWQDPVPAVSHDLVGEAEIASLKSQIRASGLTVSQLVSTAWAAASSFRGSDKRG
GANGGRIRLQPQVGWEVNDPDGDLRKVIRTLEEIQESFNSAAPGNIKVSFADLVVLGGCAAIEKAAKAAG
HNITVPFTPGRTDASQEQTDVESFAVLEPKADGFRNYLGKGNPLPAEYMLLDKANLLTLSAPEMTVLVGG
LRVLGANYKRLPLGVFTEASESLTNDFFVNLLDMGITWEPSPADDGTYQGKDGSGKVKWTGSRVDLVFGS
NSELRALVEVYGADDAQPKFVQDFVAAWDKVMNLDRFDVR

Molecule Role Protective antigen
Molecule Role Annotation DNA vaccines encoding KatG antigen fused to TPA signal sequences evoked a significant protective response in mice aerogenically challenged with low doses of Mycobacterium tuberculosis Erdman 17 to 21 days after the final immunization (Li et al., 1999).
Related Vaccines(s) M. tuberculosis DNA vaccine (containing the ESAT-6, MPT-64, MPT-83, and KatG constructs) , M. tuberculosis DNA Vaccine encoding KatG
References