VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

MPT83

Gene Name MPT83
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
VO ID VO_0012409
NCBI Gene ID 887155
NCBI Protein GI 15610010
Locus Tag Rv2873
Genbank Accession AL123456
Protein Accession NP_217389
Taxonomy ID 83332
Gene Starting Position 3183904
Gene Ending Position 3184566
Gene Strand (Orientation) +
Protein Name cell surface lipoprotein
Protein pI 4.73
Protein Weight 20581.44
Protein Length 220
Protein Note Rv2873, (MTCY274.04), len: 220 aa. mpt83 (alternate gene name: mpb83), cell surface lipoprotein (see citations below). Also similar to upstream ORF Q50769|MP70_MYCTU|MPT70|MPB70|Rv2875|MT2943|MTCY274.06 which is also known as MAJOR SECRETED IMMUNOGENIC PROTEIN MPT70 PRECURSOR from Mycobacterium tuberculosis (193 aa), FASTA scores: opt: 806, E(): 2.7e-38, (70.25% identity in 185 aa overlap). BELONGS TO THE MPT70 / MPT83 FAMILY. ATTACHED TO THE MEMBRANE BY A LIPID ANCHOR.; mpb83
DNA Sequence
>NC_000962.3:3183904-3184566 Mycobacterium tuberculosis H37Rv, complete genome
GATGATCAACGTTCAGGCCAAACCGGCCGCAGCAGCGAGCCTCGCAGCCATCGCGATTGCGTTCTTAGCG
GGTTGTTCGAGCACCAAACCCGTGTCGCAAGACACCAGCCCGAAACCGGCGACCAGCCCGGCGGCGCCCG
TTACCACGGCGGCAATGGCTGACCCCGCAGCGGACCTGATTGGTCGTGGGTGCGCGCAATACGCGGCGCA
AAATCCCACCGGTCCCGGATCGGTGGCCGGAATGGCGCAAGACCCGGTCGCTACCGCGGCTTCCAACAAC
CCGATGCTCAGTACCCTGACCTCGGCTCTGTCGGGCAAGCTGAACCCGGATGTGAATCTGGTCGACACCC
TCAACGGCGGCGAGTACACCGTTTTCGCCCCCACCAACGCCGCATTCGACAAGCTGCCGGCGGCCACTAT
CGATCAACTCAAGACTGACGCCAAGCTGCTCAGCAGCATCCTGACCTACCACGTGATAGCCGGCCAGGCG
AGTCCGAGCAGGATCGACGGCACCCATCAGACCCTGCAAGGTGCCGACCTGACGGTGATAGGCGCCCGCG
ACGACCTCATGGTCAACAACGCCGGTTTGGTATGTGGCGGAGTTCACACCGCCAACGCGACGGTGTACAT
GATCGATACGGTGCTGATGCCCCCGGCACAGTA

Protein Sequence
>NP_217389.1 cell surface lipoprotein [Mycobacterium tuberculosis H37Rv]
MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVTTAAMADPAADLIGRGCAQYAAQ
NPTGPGSVAGMAQDPVATAASNNPMLSTLTSALSGKLNPDVNLVDTLNGGEYTVFAPTNAAFDKLPAATI
DQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADLTVIGARDDLMVNNAGLVCGGVHTANATVYM
IDTVLMPPAQ

Molecule Role Protective antigen
Molecule Role Annotation A single DNA vaccine encoding the MPT-83 tuberculosis antigens evoked partial protection against an aerogenic challenge with M. tuberculosis Erdman in the mouse model of pulmonary tuberculosis (Morris et al., 2000).
Related Vaccines(s) M. tuberculosis DNA vaccine (containing the ESAT-6, MPT-64, MPT-83, and KatG constructs) , M. tuberculosis DNA vaccine encoding Ag85B, MPT64 and MPT83
References