VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Ifng (Interferon gamma)

Gene Name Ifng (Interferon gamma)
Sequence Strain (Species/Organism) Mouse
NCBI Gene ID 15978
NCBI Protein GI 33468859
Genbank Accession NM_008337
Protein Accession NP_032363.1
Other Database IDs MGI:107656; UniProt: P01580
Taxonomy ID 10090
Gene Strand (Orientation) ?
DNA Sequence
>gi|145966741|ref|NM_008337.3| Mus musculus interferon gamma (Ifng), mRNA
ATAGCTGCCATCGGCTGACCTAGAGAAGACACATCAGCTGATCCTTTGGACCCTCTGACTTGAGACAGAA
GTTCTGGGCTTCTCCTCCTGCGGCCTAGCTCTGAGACAATGAACGCTACACACTGCATCTTGGCTTTGCA
GCTCTTCCTCATGGCTGTTTCTGGCTGTTACTGCCACGGCACAGTCATTGAAAGCCTAGAAAGTCTGAAT
AACTATTTTAACTCAAGTGGCATAGATGTGGAAGAAAAGAGTCTCTTCTTGGATATCTGGAGGAACTGGC
AAAAGGATGGTGACATGAAAATCCTGCAGAGCCAGATTATCTCTTTCTACCTCAGACTCTTTGAAGTCTT
GAAAGACAATCAGGCCATCAGCAACAACATAAGCGTCATTGAATCACACCTGATTACTACCTTCTTCAGC
AACAGCAAGGCGAAAAAGGATGCATTCATGAGTATTGCCAAGTTTGAGGTCAACAACCCACAGGTCCAGC
GCCAAGCATTCAATGAGCTCATCCGAGTGGTCCACCAGCTGTTGCCGGAATCCAGCCTCAGGAAGCGGAA
AAGGAGTCGCTGCTGATTCGGGGTGGGGAAGAGATTGTCCCAATAAGAATAATTCTGCCAGCACTATTTG
AATTTTTAAATCTAAACCTATTTATTAATATTTAAAACTATTTATATGGAGAATCTATTTTAGATGCATC
AACCAAAGAAGTATTTATAGTAACAACTTATATGTGATAAGAGTGAATTCCTATTAATATATGTGTTATT
TATAATTTCTGTCTCCTCAACTATTTCTCTTTGACCAATTAATTATTCTTTCTGACTAATTAGCCAAGAC
TGTGATTGCGGGGTTGTATCTGGGGGTGGGGGACAGCCAAGCGGCTGACTGAACTCAGATTGTAGCTTGT
ACCTTTACTTCACTGACCAATAAGAAACATTCAGAGCTGCAGTGACCCCGGGAGGTGCTGCTGATGGGAG
GAGATGTCTACACTCCGGGCCAGCGCTTTAACAGCAGGCCAGACAGCACTCGAATGTGTCAGGTAGTAAC
AGGCTGTCCCTGAAAGAAAGCAGTGTCTCAAGAGACTTGACACCTGGTGCTTCCCTATACAGCTGAAAAC
TGTGACTACACCCGAATGACAAATAACTCGCTCATTTATAGTTTATCACTGTCTAATTGCATATGAATAA
AGTATACCTTTGCAACC
Protein Sequence
>gi|33468859|ref|NP_032363.1| interferon gamma [Mus musculus]
MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQI
ISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQ
LLPESSLRKRKRSRC
Molecule Role Annotation IFN-gamma plays a critical role in Th1 type immune response. It is important for protection against infections by various viruses and intracellular bacteria.
Additional Molecule Role Vaximmutor
Additional Molecule Role Annotation The experimental data demonstrated that three time vaccinations with BCG in BALB/c mice induced strong TB Ag-specific IFN-gamma immune responses in splenocytes (Wang et al., 2009).
Related Vaccines(s) Adjuvant arthritis DNA vaccine CII encoding type II collagen , B. abortus DNA vaccine pcDNA-SOD , B. abortus subunit vaccine using L7/L12 , B. abortus vaccine strain RB51 , B. melitensis DNA vaccine encoding Omp31 boosted with Omp31 , B. melitensis WR201 (16MΔpurEK) , B. pseudomallei DNA vaccine encoding Flagellin Protein , Bacille Calmette-Guérin (BCG) , Bordetella bronchiseptica bscN and cyaA double mutant vaccine , Brucella abortus pgk mutant vaccine , Brucella abortus pgm mutant vaccine , Brucella recombinant SurA protein vaccine , C. muridarum MOMP protein vaccine , C. pneumoniae CopN protein vaccine , C. pneumoniae LcrE protein vaccine , DNA vaccine expressing multiple HIV epitopes , E. coli IreA protein vaccine , F. tularensis FopB Protein Vaccine , Francisella tularensis FTL0552 mutant vaccine , HIV DNA vaccine VlJns-tPA-gp120 , HIV priming with DNA vaccine expressing HIV gp160 protein and boosted with Ad5/35 vector expressing the same protein , Japanese encephalitis virus vaccine BV-G-E , KKF24 , Leishmania donovani cen1 mutant vaccine , Listeria monocytogenes actA/plcB mutant vaccine , LVS , M. tuberculosis DNA vaccine pAK4-sod , M. tuberculosis HBHA Protein Vaccine , M. tuberculosis phoP mutant SO2 , Microencapsulated B. melitensis vjbR mutant vaccine , MVA/IL-15/5Mtb vaccine , Mycobacterium tuberculosis drrC mutant vaccine , Mycobacterium tuberculosis fadD26 mutant vaccine , Mycobacterium tuberculosis mce-2 mutant vaccine , Mycobacterium tuberculosis mce-3 mutant vaccine , Mycobacterium tuberculosis RD1/panCD mutant vaccine , Mycobacterium tuberculosis sigE mutant vaccine , Pseudorabies Subunit gB Protein Vaccine , Recombinant B. abortus RB51SOD , Rickettsia rickettsii vaccine using M. vaccae expressing R. rickettsii OmpA Protein , Rotavirus VP6 Protein Vaccine , Salmonella Typhimurium hfq mutant vaccine , Salmonella Typhimurium ruvB mutant vaccine , Staphylococcus aureus aroA mutant vaccine , Toxoplasma gondii mic2 mutant vaccine , Yersinia enterocolitica sodA mutant vaccine
References